TkA06G146930 | RubberDandelionOmics

Gene overview

TkA06G146930

Reference: TK1151 Chr: Chr06 Coordinates: 38521386-38524740 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1953 bp · TkA06G146930|TK1151|cDNA

ATGTTGATGCCGCTGCAACCATTCTACCTTCAGCGCGACCCTTCTTCATCTCCAGTTATGCTCTTCTCCATCATCACAACCGCCACCACCTTAACCTCTGTAGATAGACCCTTTTCGTCTTCCTCCTCACCCGCTGCTAGATGTAGTTCAAGGCAACTAGTCTCTACACGCAATGTTGGTAGTTCGAGTAATAAAACAGTTATGACGATTGATAAGAGGTGGACTACACTGAGGAATCGTAACTCAGATGAATTTTGGGA...

CDS

Download CDS FASTA

1953 bp · TkA06G146930|TK1151|CDS

ATGTTGATGCCGCTGCAACCATTCTACCTTCAGCGCGACCCTTCTTCATCTCCAGTTATGCTCTTCTCCATCATCACAACCGCCACCACCTTAACCTCTGTAGATAGACCCTTTTCGTCTTCCTCCTCACCCGCTGCTAGATGTAGTTCAAGGCAACTAGTCTCTACACGCAATGTTGGTAGTTCGAGTAATAAAACAGTTATGACGATTGATAAGAGGTGGACTACACTGAGGAATCGTAACTCAGATGAATTTTGGGA...

Protein

Download Protein FASTA

650 aa · TkA06G146930|TK1151|PROTEIN

MLMPLQPFYLQRDPSSSPVMLFSIITTATTLTSVDRPFSSSSSPAARCSSRQLVSTRNVGSSSNKTVMTIDKRWTTLRNRNSDEFWDGLNKFIEIIKDQADIDGLVRCPCGDCLNMLFHTPNTIHAHIYRKGFQQSYQQWIYHGEVVPPVVVEVASTTDEMAGVLNDLVGEQNTNDDSDEGNLDDGGTTVDEEFAELFEEMNTELYPGCTWLSSLTSTANLLHMKAMNKWTHSSFNQLMKFLKFAFPKDNKISSSYYEAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G146930`
TK1151 ID	TkA06G146930
OH-1004 ID	LXL04_012732
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	71.000
Protein coverage (%)	TK1151 86.000 / OH-1004 38.469 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G146930`
Location	Chr06:38521386-38524740 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012732` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.941

Rank 1 · TkA06G146930 · TK1151

Cytoplasm0.128

Rank 2 · TkA06G146930 · TK1151

Mitochondrion0.018

Rank 3 · TkA06G146930 · TK1151

Cell membrane0.015

Rank 4 · TkA06G146930 · TK1151

Extracellular0.011

Rank 5 · TkA06G146930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13963Transpos_assoc72-145 aa

PF13963Transpos_assoc225-248 aa

PF26788DUF8260285-298 aa

PF02992Transposase_21289-337 aa

PF26748zf-C2H2_Adnp2293-298 aa

PF02992Transposase_21349-555 aa

PF26788DUF8260491-504 aa

PF26748zf-C2H2_Adnp2493-504 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G146930	`PF13963`	Transpos_assoc	72	145	2.3e-19	70.0
TkA06G146930	`PF13963`	Transpos_assoc	225	248	2.3e-19	70.0
TkA06G146930	`PF26788`	DUF8260	285	298	0.11	13.2
TkA06G146930	`PF02992`	Transposase_21	289	337	3.6e-93	311.4
TkA06G146930	`PF26748`	zf-C2H2_Adnp2	293	298	5.6	7.6
TkA06G146930	`PF02992`	Transposase_21	349	555	3.6e-93	311.4
TkA06G146930	`PF26788`	DUF8260	491	504	0.11	13.2
TkA06G146930	`PF26748`	zf-C2H2_Adnp2	493	504	5.6	7.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card