TkA06G146090 | RubberDandelionOmics

Gene overview

TkA06G146090

Reference: TK1151 Chr: Chr06 Coordinates: 38291453-38292238 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · TkA06G146090|TK1151|cDNA

ATGAATATTGCAAAGCGTTTGCTGAGCAAAAACTGCCATGTTGTTGCCTCTGATATCTCTCAACGAATGGATGACTTATTAGAATTACAAGAACAAAAGATGGAAATATTGGAGCTTGATGTGTTATCAGATGAAAGTGTATCATCAGCAGTGAAGGCCATAATTTTAAAACATGGGAAGATCGATGTGTTGATCAATAATGCGGGCATTGGAAGCACGGGCCCACTTGCTGAGCTTTCCTTAGATGAGATAAAAAGGGC...

CDS

Download CDS FASTA

786 bp · TkA06G146090|TK1151|CDS

ATGAATATTGCAAAGCGTTTGCTGAGCAAAAACTGCCATGTTGTTGCCTCTGATATCTCTCAACGAATGGATGACTTATTAGAATTACAAGAACAAAAGATGGAAATATTGGAGCTTGATGTGTTATCAGATGAAAGTGTATCATCAGCAGTGAAGGCCATAATTTTAAAACATGGGAAGATCGATGTGTTGATCAATAATGCGGGCATTGGAAGCACGGGCCCACTTGCTGAGCTTTCCTTAGATGAGATAAAAAGGGC...

Protein

Download Protein FASTA

261 aa · TkA06G146090|TK1151|PROTEIN

MNIAKRLLSKNCHVVASDISQRMDDLLELQEQKMEILELDVLSDESVSSAVKAIILKHGKIDVLINNAGIGSTGPLAELSLDEIKRAYEINTLGQLRMVQHVMPSMASRRSGVIVNVGSVVGKVPTPWAGSYCASKAAVHSISHTLRLELKPFGINVVLVIPGAIRSSLGSHNTSLLSNYDWKLYKDFSDAIAERARASQVGKSTDATLFARHVVKKVLSSKPPKQVAFGHMTTLFAFLSVSPLWVRDRFFTKRFGVDKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G146090`
TK1151 ID	TkA06G146090
OH-1004 ID	LXL04_024416
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 98.467 / OH-1004 92.115 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G146090`
Location	Chr06:38291453-38292238 (-)
Description	Similar to ptmH: Short-chain dehydrogenase ptmH
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024416` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006654 phosphatidic acid biosynthetic process Biological Process GO:0019433 triglyceride catabolic process Biological Process GO:0044550 secondary metabolite biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005811 lipid droplet Cellular Component GO:0000140 acylglycerone-phosphate reductase (NADP+) activity Molecular Function GO:0004806 triacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.326

Rank 1 · TkA06G146090 · TK1151

Peroxisome0.295

Rank 2 · TkA06G146090 · TK1151

Mitochondrion0.146

Rank 3 · TkA06G146090 · TK1151

Cytoplasm0.119

Rank 4 · TkA06G146090 · TK1151

Nucleus0.065

Rank 5 · TkA06G146090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short2-169 aa

PF13561adh_short_C22-172 aa

PF08659KR20-147 aa

PF23441SDR42-201 aa

PF08643DUF177672-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G146090	`PF00106`	adh_short	2	169	2.9e-44	151.6
TkA06G146090	`PF13561`	adh_short_C2	2	172	2.7e-33	116.2
TkA06G146090	`PF08659`	KR	20	147	5.6e-06	27.1
TkA06G146090	`PF23441`	SDR	42	201	4e-07	30.4
TkA06G146090	`PF08643`	DUF1776	72	171	0.01	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card