TkA06G145480 | RubberDandelionOmics

Gene overview

TkA06G145480

Reference: TK1151 Chr: Chr06 Coordinates: 38144739-38147829 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1874 bp · TkA06G145480|TK1151|cDNA

ATATATTTGTATTTCACGAACTTGACATCCGGTCGTAAACCTTTCCCTTCCCCTGTATTCTTAAACCCTTCCGATTCGATACCAAACATCTTTCAAATGATTAGAGTCGGTTATCGCATACGAGCTTCATTCAGATTCATCCCTCAAACACTCGCACAACAATCAATCTTTCCTCCAGCTTCACACATCCCGCTTTCGTCGTTCCCTAATTCACAGGTACGGCACACACACGAAGAGGCAGATGGAGATGAATACAACAA...

CDS

Download CDS FASTA

1716 bp · TkA06G145480|TK1151|CDS

ATATATTTGTATTTCACGAACTTGACATCCGGTCGTAAACCTTTCCCTTCCCCTGTATTCTTAAACCCTTCCGATTCGATACCAAACATCTTTCAAATGATTAGAGTCGGTTATCGCATACGAGCTTCATTCAGATTCATCCCTCAAACACTCGCACAACAATCAATCTTTCCTCCAGCTTCACACATCCCGCTTTCGTCGTTCCCTAATTCACAGGTACGGCACACACACGAAGAGGCAGATGGAGATGAATACAACAA...

Protein

Download Protein FASTA

571 aa · TkA06G145480|TK1151|PROTEIN

IYLYFTNLTSGRKPFPSPVFLNPSDSIPNIFQMIRVGYRIRASFRFIPQTLAQQSIFPPASHIPLSSFPNSQVRHTHEEADGDEYNKDPDSPPRLFVVQPRFRPDAILKTKLDEALNLANSLEEQRDGYYGTDFSKKEIPPHIVVQNPAYRTIRADTFFGPGTVDNIKCHLNAEDSKDGVDAVFVNGILTGIQQRNLEREWGKAVLDRVGLIIEIFHAHAQTKEAKLQAELAALMYKRTRLVRIRGSNGRSTFGGEAEVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G145480`
TK1151 ID	TkA06G145480
OH-1004 ID	LXL04_024422
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 98.424 / OH-1004 99.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G145480

Location Chr06:38144739-38147829 (-)

Description Similar to At3g49725: GTP-binding protein At3g49725, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49725`	GTP-binding protein At3g49725, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024422 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0043022 ribosome binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G49725

csh:Closa_2505

mgm:Mmc1_0278

tte:TTE1127

xla:447064

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.714

Rank 1 · TkA06G145480 · TK1151

Plastid0.263

Rank 2 · TkA06G145480 · TK1151

Nucleus0.065

Rank 3 · TkA06G145480 · TK1151

Cytoplasm0.049

Rank 4 · TkA06G145480 · TK1151

Cell membrane0.013

Rank 5 · TkA06G145480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13167GTP-bdg_N151-216 aa

PF01926MMR_HSR1205-223 aa

PF16360GTP-bdg_M219-313 aa

PF10139Virul_Fac287-346 aa

PF09439SRPRB292-307 aa

PF05621TniB322-353 aa

PF00009GTP_EFTU324-346 aa

PF09439SRPRB324-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G145480	`PF13167`	GTP-bdg_N	151	216	1.4e-11	45.6
TkA06G145480	`PF01926`	MMR_HSR1	205	223	1.9e-17	64.1
TkA06G145480	`PF16360`	GTP-bdg_M	219	313	8.5e-17	62.2
TkA06G145480	`PF10139`	Virul_Fac	287	346	0.22	10.3
TkA06G145480	`PF09439`	SRPRB	292	307	0.032	14.3
TkA06G145480	`PF05621`	TniB	322	353	0.022	14.9
TkA06G145480	`PF00009`	GTP_EFTU	324	346	4.6e-05	23.8
TkA06G145480	`PF09439`	SRPRB	324	445	0.032	14.3
TkA06G145480	`PF02492`	cobW	325	344	0.72	10.2
TkA06G145480	`PF01926`	MMR_HSR1	326	447	1.9e-17	64.1
TkA06G145480	`PF02421`	FeoB_N	326	447	2.2e-06	28.0
TkA06G145480	`PF13555`	AAA_29	326	345	0.14	12.7
TkA06G145480	`PF09818`	ABC_ATPase	327	389	0.0047	16.7
TkA06G145480	`PF00025`	Arf	327	349	0.15	12.3
TkA06G145480	`PF00350`	Dynamin_N	327	350	0.2	12.4
TkA06G145480	`PF02492`	cobW	373	462	0.72	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTB4`	Arabidopsis thaliana	sp\|Q0WTB4\|Y3725_ARATH GTP-binding protein At3g49725, chloroplastic	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card