LXL04_024422 | RubberDandelionOmics

Gene overview

LXL04_024422

Reference: OH-1004 Chr: Chr05 Coordinates: 90140400-90143314 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_024422|LXL04_024422|OH1004|cDNA

atatatttgtaTTTCACGAACTTGACATCCGGTCGTAAACCTTTCCCTTCCCCTGTATTCTTAAACCCTTCCGATTCGATACCAAACATCTTTCAAATGATTAGAGTCGGTTATCGCATACGAGCTTCATTCAGATTCATCCCTCAAACACTCGCACAACAATCAATCTTTCCTCCAGCTTCACACATCCCGCTTTCGTCGTTCCCTAATTCACAGGTACGGCACACACACGAAGAGGCAGATGGAGATGAATACAACAA...

CDS

Download CDS FASTA

1752 bp · LXL04_024422|LXL04_024422|OH1004|CDS

TTGTATTTCACGAACTTGACATCCGGTCGTAAACCTTTCCCTTCCCCTGTATTCTTAAACCCTTCCGATTCGATACCAAACATCTTTCAAATGATTAGAGTCGGTTATCGCATACGAGCTTCATTCAGATTCATCCCTCAAACACTCGCACAACAATCAATCTTTCCTCCAGCTTCACACATCCCGCTTTCGTCGTTCCCTAATTCACAGGTACGGCACACACACGAAGAGGCAGATGGAGATGAATACAACAAAGATCC...

Protein

Download Protein FASTA

583 aa · LXL04_024422|LXL04_024422|OH1004|PROTEIN

MYFTNLTSGRKPFPSPVFLNPSDSIPNIFQMIRVGYRIRASFRFIPQTLAQQSIFPPASHIPLSSFPNSQVRHTHEEADGDEYNKDPDSPPRLFVVQPRFRPDAILKTKLDEALNLANSLEEQRDGYYGTDFSKKEIPPHIVVQNPAYRTIRADTFFGPGTVDNIKCHLNAEDSKDGVDAVFVNGILTGIQQRNLEREWGKAVLDRVGLIIEIFHAHAQTKEAKLQAELAALMYKRTRLVRIRGSNGRSTFGGEAEVVSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024422`
TK1151 ID	TkA06G145480
OH-1004 ID	LXL04_024422
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 98.424 / OH-1004 99.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024422

Location Chr05:90140400-90143314 (+)

Description Similar to At3g49725: GTP-binding protein At3g49725, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49725`	GTP-binding protein At3g49725, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024422 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0043022 ribosome binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G49725

csh:Closa_2505

mgm:Mmc1_0278

tte:TTE1127

xla:447064

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.552

Rank 1 · LXL04_024422 · OH-1004

Plastid0.421

Rank 2 · LXL04_024422 · OH-1004

Nucleus0.062

Rank 3 · LXL04_024422 · OH-1004

Cytoplasm0.043

Rank 4 · LXL04_024422 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_024422 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13167.12GTP-bdg_N149-214 aa

PF16360.11GTP-bdg_M217-311 aa

PF01926.30MMR_HSR1324-445 aa

PF02421.25FeoB_N324-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024422	`PF13167.12`	GTP-bdg_N	149	214	1.4e-11	45.5
LXL04_024422	`PF16360.11`	GTP-bdg_M	217	311	8.7e-17	62.1
LXL04_024422	`PF01926.30`	MMR_HSR1	324	445	1.1e-17	64.9
LXL04_024422	`PF02421.25`	FeoB_N	324	445	2.1e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTB4`	Arabidopsis thaliana	GTP-binding protein At3g49725, chloroplastic	55.319%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card