TkA06G143500 | RubberDandelionOmics

Gene overview

TkA06G143500

Reference: TK1151 Chr: Chr06 Coordinates: 37607379-37608676 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · TkA06G143500|TK1151|cDNA

AGACGATGGAGACAGACGCAACGGATACTACGTAGATTCGCTAGGGACTGTGCTACTCCGGTGCCAAAGCTATGGCATGTTGCGTTCGATTTGGTTTCTGATATGCAAACGAGCCTCTCCGATCAATCTCAGACGGATTTCGTCATGCTTCCATCATACACCTCCTCGCTTCCGAACGGTAACGAGGAAGGTTTATATTACGGTGTGAATTTACGTGAAGACAATTTCTTATTGTTGAGTGCGCGGCTGAGAGGTAAACA...

CDS

Download CDS FASTA

345 bp · TkA06G143500|TK1151|CDS

AGACGATGGAGACAGACGCAACGGATACTACGTAGATTCGCTAGGGACTGTGCTACTCCGGTGCCAAAGCTATGGCATGTTGCGTTCGATTTGGTTTCTGATATGCAAACGAGCCTCTCCGATCAATCTCAGACGGATTTCGTCATGCTTCCATCATACACCTCCTCGCTTCCGAACGGTAACGAGGAAGGTTTATATTACGGTGTGAATTTACGTGAAGACAATTTCTTATTGTTGAGTGCGCGGCTGAGAGGTAAACA...

Protein

Download Protein FASTA

114 aa · TkA06G143500|TK1151|PROTEIN

RRWRQTQRILRRFARDCATPVPKLWHVAFDLVSDMQTSLSDQSQTDFVMLPSYTSSLPNGNEEGLYYGVNLREDNFLLLSARLRGKHESITDLQREEVDIPAEVISGGLKMISA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G143500`
TK1151 ID	TkA06G143500
OH-1004 ID	LXL04_024442
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.491 / OH-1004 18.739 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G143500

Location Chr06:37607379-37608676 (+)

Description Similar to At4g37840: Probable hexokinase-like 2 protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37840`	Fructose and glucose phosphorylating enzyme.	No verified direct reference in this release
`At1g47840`	Fructose and glucose phosphorylating enzyme.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0522500`	Fructose and glucose phosphorylating enzyme.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024442 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001678 intracellular glucose homeostasis Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009749 response to glucose Biological Process

KEGG gene cross-reference

ath:AT4G29130

ath:AT4G37840

nta:107797523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.575

Rank 1 · TkA06G143500 · TK1151

Cytoplasm0.395

Rank 2 · TkA06G143500 · TK1151

Mitochondrion0.075

Rank 3 · TkA06G143500 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA06G143500 · TK1151

Cell membrane0.027

Rank 5 · TkA06G143500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00349Hexokinase_110-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G143500	`PF00349`	Hexokinase_1	10	107	2.2e-16	61.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T071`	Arabidopsis thaliana	sp\|Q9T071\|HXKL2_ARATH Probable hexokinase-like 2 protein	52.700%	Swiss-Prot	High
`Q9FZG4`	Arabidopsis thaliana	sp\|Q9FZG4\|HXKL1_ARATH Hexokinase-like 1 protein	37.400%	Swiss-Prot	Medium
`Q5W676`	Oryza sativa subsp. japonica	sp\|Q5W676\|HXK5_ORYSJ Hexokinase-5	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card