TkA06G140810 | RubberDandelionOmics

Gene overview

TkA06G140810

Reference: TK1151 Chr: Chr06 Coordinates: 36926264-36927218 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA06G140810|TK1151|cDNA

ATGATTCTCAAGAAATGCATAGAGAGATACGGAGAGGGAAAATGGCACCTCATTCCTCTAAAAGCAGGTTTAAAAAGATGCAGAAAAAGTTGCAGACTACGATGGTTGAATTATTTAAGACCAAACATAAAGAGAGGTGATTTTAGTAAAGATGAAGTTGATCTCATGCTTAGACTTCACAAGCTTTTAGGGAACAGGTGGTCATTGATTGCGGGGAGATTACCCGGAAGAACTGCTAATGACGTGAAAAACTATTGGAA...

CDS

Download CDS FASTA

651 bp · TkA06G140810|TK1151|CDS

ATGATTCTCAAGAAATGCATAGAGAGATACGGAGAGGGAAAATGGCACCTCATTCCTCTAAAAGCAGGTTTAAAAAGATGCAGAAAAAGTTGCAGACTACGATGGTTGAATTATTTAAGACCAAACATAAAGAGAGGTGATTTTAGTAAAGATGAAGTTGATCTCATGCTTAGACTTCACAAGCTTTTAGGGAACAGGTGGTCATTGATTGCGGGGAGATTACCCGGAAGAACTGCTAATGACGTGAAAAACTATTGGAA...

Protein

Download Protein FASTA

216 aa · TkA06G140810|TK1151|PROTEIN

MILKKCIERYGEGKWHLIPLKAGLKRCRKSCRLRWLNYLRPNIKRGDFSKDEVDLMLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTRNRYNSKQQNTKLKDNESLPVTIVKPQPRTFSKTLFQCTGENQHIKNNTLRSSNLILSPNVLDDSSNEYLDDLLFDDCEKERGNQIGWSFGYHTKGAVSNVVEQVDDHYNSLFDFPIDEAMWELTNQD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G140810`
TK1151 ID	TkA06G140810
OH-1004 ID	LXL04_024462
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.500
Protein coverage (%)	TK1151 100.000 / OH-1004 90.164 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G140810

Location Chr06:36926264-36927218 (-)

Description Similar to MYB113: Transcription factor MYB113

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66390`	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3.	No verified direct reference in this release
`At1g66380`	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8.	No verified direct reference in this release
`At1g66370`	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8.	No verified direct reference in this release
`At1g56650`	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3.	Sucrose-specific induction of anthocyanin biosynthesis in Arabidopsis requires the MYB75/PAP1 gene.2005 · DOI: 10.1104/pp.105.066688

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024462 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009745 sucrose mediated signaling Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0019430 removal of superoxide radicals Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0031542 positive regulation of anthocyanin biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G56650

ath:AT1G66370

ath:AT1G66380

ath:AT1G66390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.934

Rank 1 · TkA06G140810 · TK1151

Cytoplasm0.165

Rank 2 · TkA06G140810 · TK1151

Mitochondrion0.020

Rank 3 · TkA06G140810 · TK1151

Cell membrane0.019

Rank 4 · TkA06G140810 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA06G140810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding2-39 aa

PF13921Myb_DNA-bind_62-54 aa

PF15963Myb_DNA-bind_744-106 aa

PF00249Myb_DNA-binding45-88 aa

PF13921Myb_DNA-bind_648-94 aa

PF14266YceG_bac78-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G140810	`PF00249`	Myb_DNA-binding	2	39	1.6e-26	92.9
TkA06G140810	`PF13921`	Myb_DNA-bind_6	2	54	2.6e-15	57.1
TkA06G140810	`PF15963`	Myb_DNA-bind_7	44	106	0.059	13.9
TkA06G140810	`PF00249`	Myb_DNA-binding	45	88	1.6e-26	92.9
TkA06G140810	`PF13921`	Myb_DNA-bind_6	48	94	2.6e-15	57.1
TkA06G140810	`PF14266`	YceG_bac	78	144	0.097	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZTC3`	Arabidopsis thaliana	sp\|Q9ZTC3\|MYB90_ARATH Transcription factor MYB90	65.100%	Swiss-Prot	Medium
`Q9FNV8`	Arabidopsis thaliana	sp\|Q9FNV8\|MY114_ARATH Transcription factor MYB114	83.900%	Swiss-Prot	Low
`Q9FNV9`	Arabidopsis thaliana	sp\|Q9FNV9\|MY113_ARATH Transcription factor MYB113	62.300%	Swiss-Prot	Medium
`Q9FE25`	Arabidopsis thaliana	sp\|Q9FE25\|MYB75_ARATH Transcription factor MYB75	61.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card