Gene Card
Gene overview
cDNA / CDS / Protein Sequences
853 bp · TkA06G140740|TK1151|cDNA
CAGTCGCTCACCTCTAATTGCCCTAAACTCGGCTGCTCATCTCTTCCCGTCTTCCGCAATACCTTCGCAAATACCAGCTGCATTTTTTCCCAAATGTCGATAATTGCCCTAAGTTGAAGCTCTCGAAATGATTTGAAGACTCCGACGCTGATCGCCGACATCACTGCTTCTCCTTCCTTTCTCACACGCATGACACATAGAGTAAAAATTCAGTAATGGGAAACATCGGCCCCTTGATCAGAGGTTACCTCACGAAACTA...
525 bp · TkA06G140740|TK1151|CDS
ATGGGAAACATCGGCCCCTTGATCAGAGGTTACCTCACGAAACTAAAGCAAGCATCGGTGTTATGGCTCGAAAGTTTTCGAGAAACTTGCTGTCTTCACAGAGTCGTCATCTACTGTCTCAGGTCGAGGCAACTGATGATTCGCACCAGACAGTGCTTTCTCTTGAACGGTCTTATCTTTTTAGGGAGTATTTTGAACCTAAGATCTCTAATCATTCCAACACTACATTGGATATTGCCCTTTGAAGTCTCGGGTGGTGA...
Protein
Download Protein FASTA174 aa · TkA06G140740|TK1151|PROTEIN
MGNIGPLIRGYLTKLKQASVLWLESFRETCCLHRVVIYCLRSRQLMIRTRQCFLLNGLIFLGSILNLRSLIIPTLHWILPFEVSGGDQDACLPQMPIRLYAFLRLGLLQLIYLHKYGRIKSVPNQPKKSSSQNQASPSSSHALVLSGTINLISNFLISILSCWFLLTVIYTALH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G140740 |
|---|---|
| TK1151 ID | TkA06G140740 |
| OH-1004 ID | LXL04_024463 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 71.200 |
| Protein coverage (%) | TK1151 85.057 / OH-1004 53.803Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G140740 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:36888801-36890720 (-) | |||||||||
| Description | Similar to At4g06676: Protein EI24 homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006396 RNA processing Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006897 endocytosis Biological Process GO:0006955 immune response Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009749 response to glucose Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0010154 fruit development Biological Process GO:0010182 sugar mediated signaling pathway Biological Process GO:0010215 cellulose microfibril organization Biological Process GO:0016192 vesicle-mediated transport Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G16650 ath:AT3G43300 ath:AT4G06676 ath:AT4G15900 mmu:53317 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07264EI2431-142 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G140740 | PF07264 | EI24 | 31 | 142 | 0.023 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.