Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1156 bp · TkA06G137590|TK1151|cDNA
ATATCAATAAAAAAATGGACAACTTTTTGCATAATTAAATACACAGCCGGCGGCTATATAATCCATGGTGATAGTACATTTATGTACGCTCATCTTCTTCTCTTCTTTCACGATCAAACTCTAATCACCTGACCTCCGCCGGGTTTTCGCCGGAAACAACCTCCGCCACCTCACTGCTAAGTCTTTTCCGATGGATGAAAACTATTTGCAATTGTTTGTGGATGAAACGTCGTTGACCAACCAGCTTGTGCTCGGGACAC...
825 bp · TkA06G137590|TK1151|CDS
ATGGATGAAAACTATTTGCAATTGTTTGTGGATGAAACGTCGTTGACCAACCAGCTTGTGCTCGGGACACTGCTGCCGGCGAAGATATGGGAGCCGTTACCGCACTTTTTTCAGACATGGCTCCGGAATTACACCGCCGGAACCTTAGTTTATTTCATCACAAGTTTCCTTTGGAGCTTCTATGTTTATTTCTACAAATACAACGTTTACGTTCCTAAAGATGCAATTCCTTCGAGAAAAGCAATGGGTTTACAAATATA...
Protein
Download Protein FASTA274 aa · TkA06G137590|TK1151|PROTEIN
MDENYLQLFVDETSLTNQLVLGTLLPAKIWEPLPHFFQTWLRNYTAGTLVYFITSFLWSFYVYFYKYNVYVPKDAIPSRKAMGLQIYVAMKAMPWYCALPTVSEYMVENGWTRCFSRINRRRMVFICLNLGFYLILVEFGIYWMHRELHDIKPLYKYLHATHHIYKQTAKHTLTFAGLAFHPLDGILQAVPHVIALFLVPTHFTTHIGLLFIEAIWTANIHDCVDGKIWPVMGAGYHTIHHTTYRHNYGHYTVWMDWMFG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G137590 |
|---|---|
| TK1151 ID | TkA06G137590 |
| OH-1004 ID | LXL04_013705 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 75.000 |
| Protein coverage (%) | TK1151 97.445 / OH-1004 98.155Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G137590 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:36013242-36020630 (+) | |||||||||
| Description | Similar to Delta(7)-sterol-C5(6)-desaturase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006631 fatty acid metabolic process Biological Process GO:0006695 cholesterol biosynthetic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0016132 brassinosteroid biosynthetic process Biological Process GO:0033489 cholesterol biosynthetic process via desmosterol Biological Process GO:0033490 cholesterol biosynthetic process via lathosterol Biological Process GO:0110076 negative regulation of ferroptosis Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0000248 C-5 sterol desaturase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0050046 delta7-sterol 5(6)-desaturase activity Molecular Function | |||||||||
| KEGG gene cross-reference | afm:AFUA_6G05140 ath:AT3G02580 ath:AT3G02590 nta:107762070 rno:114100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04116FA_hydroxylase46-63 aaPF04116FA_hydroxylase132-261 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G137590 | PF04116 | FA_hydroxylase | 46 | 63 | 3.1e-19 | 70.4 |
| TkA06G137590 | PF04116 | FA_hydroxylase | 132 | 261 | 3.1e-19 | 70.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.