TkA06G133610 | RubberDandelionOmics

Gene overview

TkA06G133610

Reference: TK1151 Chr: Chr06 Coordinates: 34892341-34893962 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA06G133610|TK1151|cDNA

AAGCAACAGCAGACTACTTAGTCTTCACTCCACCTTTATAAATAAAGTCTCCCTTGATGTACCCACTCTAAGACATCCACTTGTTTCACCAAACAAGAACACCTCTGCCAAGTGTTGAGAAACACAGAGAGAGAAAGATCAAAGATGACAAGCAATTTGAAATCTCAAGCCGATGATCAAATGGTTCTCCTCTCCCATTATTATCCCGGGATTTACGATCAACTCATTCCAGAACAAGGGGAAGTTGCGAAGCCACGAAG...

CDS

Download CDS FASTA

384 bp · TkA06G133610|TK1151|CDS

ATGATCAAATGGTTCTCCTCTCCCATTATTATCCCGGGATTTACGATCAACTCATTCCAGAACAAGGGGAAGTTGCGAAGCCACGAAGAGAAACGAAAGAAGAACAAAGGAGATGGGAACAGTAGCGTGATGAGAAAAAGGAAGCTGAGTGATGAGCAAGTGAATCTTCTAGAACAAAACTTCGGAAATGAACATAAATTGGAGTCGGAAAGAAAAGATCGGCTTGCTTCTGAACTTGGGCTTGACCCGCGTCAAGTTGC...

Protein

Download Protein FASTA

127 aa · TkA06G133610|TK1151|PROTEIN

MIKWFSSPIIIPGFTINSFQNKGKLRSHEEKRKKNKGDGNSSVMRKRKLSDEQVNLLEQNFGNEHKLESERKDRLASELGLDPRQVAVWFQNGGLGGRVRSSKRNTRSSRINMTPLFLRNANSNLRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G133610`
TK1151 ID	TkA06G133610
OH-1004 ID	LXL04_024539
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.000
Protein coverage (%)	TK1151 63.780 / OH-1004 39.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G133610

Location Chr06:34892341-34893962 (-)

Description Similar to ATHB-40: Homeobox-leucine zipper protein ATHB-40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36740`	Probable transcription factor.	No verified direct reference in this release
`At5g66700`	Probable transcription factor that may play a regulatory role in auxin/cytokinin signaling during root development.	No verified direct reference in this release
`At2g18550`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0581700`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2YN17`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024539 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009725 response to hormone Biological Process

GO:0009733 response to auxin Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G18550

ath:AT4G36740

ath:AT5G66700

dosa:Os07g0581700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · TkA06G133610 · TK1151

Cytoplasm0.120

Rank 2 · TkA06G133610 · TK1151

Cell membrane0.025

Rank 3 · TkA06G133610 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA06G133610 · TK1151

Mitochondrion0.011

Rank 5 · TkA06G133610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13551HTH_2916-35 aa

PF17380DUF540122-89 aa

PF11718CPSF73-100_C24-92 aa

PF14632SPT6_acidic27-75 aa

PF05920Homeobox_KN45-55 aa

PF13551HTH_2945-53 aa

PF00046Homeodomain47-92 aa

PF05920Homeobox_KN70-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G133610	`PF13551`	HTH_29	16	35	1.7	9.5
TkA06G133610	`PF17380`	DUF5401	22	89	0.2	10.4
TkA06G133610	`PF11718`	CPSF73-100_C	24	92	0.18	12.1
TkA06G133610	`PF14632`	SPT6_acidic	27	75	0.12	13.4
TkA06G133610	`PF05920`	Homeobox_KN	45	55	0.002	18.7
TkA06G133610	`PF13551`	HTH_29	45	53	1.7	9.5
TkA06G133610	`PF00046`	Homeodomain	47	92	8.3e-13	48.7
TkA06G133610	`PF05920`	Homeobox_KN	70	92	0.002	18.7
TkA06G133610	`PF13551`	HTH_29	72	111	1.7	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23208`	Arabidopsis thaliana	sp\|O23208\|ATB40_ARATH Homeobox-leucine zipper protein ATHB-40	66.700%	Swiss-Prot	Medium
`Q9LVR0`	Arabidopsis thaliana	sp\|Q9LVR0\|ATB53_ARATH Homeobox-leucine zipper protein ATHB-53	78.000%	Swiss-Prot	Low
`Q9ZU70`	Arabidopsis thaliana	sp\|Q9ZU70\|ATB21_ARATH Homeobox-leucine zipper protein ATHB-21	75.900%	Swiss-Prot	Low
`Q7XI85`	Oryza sativa subsp. japonica	sp\|Q7XI85\|HOX14_ORYSJ Homeobox-leucine zipper protein HOX14	70.800%	Swiss-Prot	Low
`A2YN17`	Oryza sativa subsp. indica	sp\|A2YN17\|HOX14_ORYSI Homeobox-leucine zipper protein HOX14	70.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card