TkA06G133450 | RubberDandelionOmics

Gene overview

TkA06G133450

Reference: TK1151 Chr: Chr06 Coordinates: 34848081-34851167 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2233 bp · TkA06G133450|TK1151|cDNA

CGATGGCAGACCATACCCCACCACCCCTTCCCTCATGCATATCGTTGTTAGAAAAACCCCACAATCATCGCCTCCAAAAGCCCCCCAACCCACTTCCTTTTTCGCTCAAAAGCTTGAAAATTCAACAAGAAGAGAAGAGGAAAGAAAAAGGTTTAGTTGCGTACCCGTAGCATTAGCTTTTGAGGCATGAAATTGCCCTTTGCTTCACAGCAAAACAATCTCTCTTCTCCTGACGTAAAGAACCAAATCATCAGTAGTGG...

CDS

Download CDS FASTA

1563 bp · TkA06G133450|TK1151|CDS

ATGAAATTGCCCTTTGCTTCACAGCAAAACAATCTCTCTTCTCCTGACGTAAAGAACCAAATCATCAGTAGTGGTGGTGGTGGTGGTGGAACTGGTCGATACGAGCCCAAATCGGTTCTTGATATTTGCCGGAGTTTGCCTGGTAAGTCGTCGGAGTTTGATTCCGTTGATCATAATAGCATTGGGTTATCATCATCTGAGGATCCGTTGCGGTTGGATAACTACGAACATGGAATCGTGAATCAGTTTGAAGAATGGGA...

Protein

Download Protein FASTA

520 aa · TkA06G133450|TK1151|PROTEIN

MKLPFASQQNNLSSPDVKNQIISSGGGGGGTGRYEPKSVLDICRSLPGKSSEFDSVDHNSIGLSSSEDPLRLDNYEHGIVNQFEEWDSLMKELGLNDDSAKSAYLPELPDLPPIQSEVTAPTMSLFLNPDFENPNTNPNPNQLEFTSQYNTDNRTGFDFIDDIIRIAECFETQSLHLAQVILARLNQRLPSPNGKALQRAAFYFKEALQSLITGSTRLTQSSSSSEIVQTIKAYKTFSTVSPIPMFSNFTANQAILEAVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G133450`
TK1151 ID	TkA06G133450
OH-1004 ID	LXL04_024540
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G133450

Location Chr06:34848081-34851167 (+)

Description Similar to SCL15: Scarecrow-like protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36710`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At4g00150`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At3g60630`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g45160`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0610300`	Putative transcription regulator that controls rice tillering by initiating axillary buds and promoting their outgrowth.	Control of tillering in rice.2003 · DOI: 10.1038/nature01518

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024540 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

KEGG gene cross-reference

ath:AT2G45160

ath:AT3G60630

ath:AT4G00150

ath:AT4G36710

mtr:25489240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.904

Rank 1 · TkA06G133450 · TK1151

Cytoplasm0.161

Rank 2 · TkA06G133450 · TK1151

Cell membrane0.034

Rank 3 · TkA06G133450 · TK1151

Endoplasmic reticulum0.031

Rank 4 · TkA06G133450 · TK1151

Plastid0.020

Rank 5 · TkA06G133450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05292MCD79-119 aa

PF03514GRAS81-96 aa

PF03514GRAS161-519 aa

PF05292MCD225-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G133450	`PF05292`	MCD	79	119	0.17	12.2
TkA06G133450	`PF03514`	GRAS	81	96	6e-92	309.1
TkA06G133450	`PF03514`	GRAS	161	519	6e-92	309.1
TkA06G133450	`PF05292`	MCD	225	252	0.17	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23210`	Arabidopsis thaliana	sp\|O23210\|SCL15_ARATH Scarecrow-like protein 15	50.600%	Swiss-Prot	High
`O81316`	Arabidopsis thaliana	sp\|O81316\|SCL6_ARATH Scarecrow-like protein 6	35.800%	Swiss-Prot	Medium
`Q9M000`	Arabidopsis thaliana	sp\|Q9M000\|SCL22_ARATH Scarecrow-like protein 22	35.700%	Swiss-Prot	Medium
`Q7XJM8`	Arabidopsis thaliana	sp\|Q7XJM8\|SCL27_ARATH Scarecrow-like protein 27	35.900%	Swiss-Prot	Medium
`Q84MM9`	Oryza sativa subsp. japonica	sp\|Q84MM9\|MOC_ORYSJ Protein MONOCULM 1	27.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card