TkA06G132950 | RubberDandelionOmics

Gene overview

TkA06G132950

Reference: TK1151 Chr: Chr06 Coordinates: 34756686-34759298 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2272 bp · TkA06G132950|TK1151|cDNA

TAATAAATCAATCCCCAATTCCTCACTTCCATAGCACACTGGTCGGAAATTCAAGAAAAAAATGCCTACAACTTCCTTTTCAATTCGTATTCTACTATCTGCATACTTTCTTACAACTCTCTGCTTCTTCTCCCCTAACCAGCAACAGCTTTGCACGTTGGGGAAGCGGAGGAAGAAGGTGGCGGTCCTCCGGTACCGGTGCCGGCAAGGCATGGAGCAGTGGTGAAGAAAGATAAGAGATGGAGTGTGGTTACGACGGA...

CDS

Download CDS FASTA

1251 bp · TkA06G132950|TK1151|CDS

ATGATCGATGTCAGTAATAAAAATAAAAAATACAAAGCGTATAATATACTCACGGCAGATCACGACGTTGAGAATTGCAATGGGTGGAGTCTTGTTGTAACGAGTAAACAATTAGACGTGTTAAAGGACTCCGATTTCAGTATCTTTATGGTCAATCTAACCAAGGGAGCGATGATGGGCCCACACTGGAACCCGACAACGGCGGAGATAGGGGTTGTGGTGAAAGGACGTGGGATGGTGCATGTGGTGTGTCCTCGAAC...

Protein

Download Protein FASTA

416 aa · TkA06G132950|TK1151|PROTEIN

MIDVSNKNKKYKAYNILTADHDVENCNGWSLVVTSKQLDVLKDSDFSIFMVNLTKGAMMGPHWNPTTAEIGVVVKGRGMVHVVCPRTLNETECKNSRFRVEEGDVFVAPRYHPMAQMSFNNGSFVFMGFTTTTKKNHPQYLVGKASVLQVLDMRVLAASFGVSNTTMVEVLNAQREAIILECASCAEEEERLMEEEIQREKEEEAKRREEEERKKEEEEAKRREEEEEEAKRREEEEAKRREEEEEAKRREEEEAKRREE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G132950`
TK1151 ID	TkA06G132950
OH-1004 ID	LXL04_024543
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 47.356 / OH-1004 26.197 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G132950

Location Chr06:34756686-34759298 (-)

Description Similar to At2g18540: Vicilin-like seed storage protein At2g18540

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18540`	Seed storage protein.	No verified direct reference in this release
`At4g36700`	Seed storage protein.	No verified direct reference in this release
`At2g28490`	Seed storage protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024543 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010431 seed maturation Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048316 seed development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070207 protein homotrimerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0019863 IgE binding Molecular Function

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT2G18540

ath:AT2G28490

ath:AT4G36700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · TkA06G132950 · TK1151

Nucleus0.285

Rank 2 · TkA06G132950 · TK1151

Cell membrane0.146

Rank 3 · TkA06G132950 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA06G132950 · TK1151

Extracellular0.072

Rank 5 · TkA06G132950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_114-166 aa

PF07883Cupin_250-110 aa

PF27837Fyv8198-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G132950	`PF00190`	Cupin_1	14	166	2.2e-34	118.9
TkA06G132950	`PF07883`	Cupin_2	50	110	0.00032	21.1
TkA06G132950	`PF27837`	Fyv8	198	367	0.34	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IQK5`	Arabidopsis thaliana	sp\|F4IQK5\|VCL21_ARATH Vicilin-like seed storage protein At2g18540	57.400%	Swiss-Prot	Low
`F4JQG6`	Arabidopsis thaliana	sp\|F4JQG6\|VCL43_ARATH Vicilin-like seed storage protein At4g36700	53.200%	Swiss-Prot	Low
`Q9SK09`	Arabidopsis thaliana	sp\|Q9SK09\|VCL22_ARATH Vicilin-like seed storage protein At2g28490	44.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card