Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2451 bp · TkA06G123620|TK1151|cDNA
TAAATTTTAATTATTAAACTAAAATACCTTCAATTATATTACATAAATTATTTTATCCCGTGTAGTACACGGATTAAAAACCTACTTGTTTACTAAAATGGAAACGATGCAGTTTCAGTTACATGGAAATTAAAATACTGCAAATTCAATAACGTTAGCCTTATATAAACCGGGTTCGGAGCAGTTTCGGGTTGGTCTTTCACGCATCCCAGCGGGCTGCGGGTGCGAGGGCTTCCCAGTTCAAGCCACGTTCCCCCTAT...
1818 bp · TkA06G123620|TK1151|CDS
ATGGCGGCCTCTCTCTCCTCTATCTCCGCCCTTCGCATCAAACTTCACAGACATTCCTTCAATACCAGGCTTATTTCCTCCTCTTCAAACCCCCAACAGTTCTTCATTATTTCACCCCGTCTTCCCCCAAAACGCCGTTTCATTAGGCCTTTCTCCCTCAAATTATCAAGAAGTTTCTCAATTAACTCCATATTCAATGATGATAAGAAGAACAGTAACCCTAGCTTTCACCATTTCATCGCTCAAGCTCAAGCGACCGC...
Protein
Download Protein FASTA605 aa · TkA06G123620|TK1151|PROTEIN
MAASLSSISALRIKLHRHSFNTRLISSSSNPQQFFIISPRLPPKRRFIRPFSLKLSRSFSINSIFNDDKKNSNPSFHHFIAQAQATALTASDATQADDVPSSEVLPRGRIYQETYGCQMNVNDMEIVLSVMKKAGYDEIVNDPESAEIIFINTCAIRDNAEQRVWQRLNYFWFLKRHWKSNVATGRSHSLHPPKVVVLGCMAERLKDKILDSDKMVDVVCGPDAYRDLPRLLAEVENGQKGINTLLSLEETYADISPVRI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G123620 |
|---|---|
| TK1151 ID | TkA06G123620 |
| OH-1004 ID | LXL04_024624 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 91.736 / OH-1004 90.113Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G123620 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:32209485-32212364 (-) | ||||||||||||
| Description | Similar to At4g36390: CDK5RAP1-like protein | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process GO:0009451 RNA modification Biological Process GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0045903 positive regulation of translational fidelity Biological Process GO:0060255 regulation of macromolecule metabolic process Biological Process GO:0070131 positive regulation of mitochondrial translation Biological Process GO:0070900 mitochondrial tRNA modification Biological Process GO:0080090 regulation of primary metabolic process Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT4G36390 dosa:Os11g0592800 hsa:51654 mmu:66971 rno:252827 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00919UPF0004109-221 aaPF04055Radical_SAM121-144 aaPF21911PG_1098_N239-260 aaPF04055Radical_SAM269-463 aaPF13353Fer4_12272-318 aaPF01938TRAM519-553 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G123620 | PF00919 | UPF0004 | 109 | 221 | 4.1e-25 | 88.4 |
| TkA06G123620 | PF04055 | Radical_SAM | 121 | 144 | 4.9e-26 | 92.6 |
| TkA06G123620 | PF21911 | PG_1098_N | 239 | 260 | 0.16 | 12.2 |
| TkA06G123620 | PF04055 | Radical_SAM | 269 | 463 | 4.9e-26 | 92.6 |
| TkA06G123620 | PF13353 | Fer4_12 | 272 | 318 | 0.22 | 12.6 |
| TkA06G123620 | PF01938 | TRAM | 519 | 553 | 0.031 | 14.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.