TkA06G123350 | RubberDandelionOmics

Gene overview

TkA06G123350

Reference: TK1151 Chr: Chr06 Coordinates: 32131438-32136983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1987 bp · TkA06G123350|TK1151|cDNA

ATTACACCCATCCTCCTCTCTCTCTCTCTCTCTCATATTTATTACCCGAAAGCCTCCTGCTTTTCTGCTCTATTTAGATTTCAAAATCTTCCCAATTCGCTATATATGTCATAGAAAGAAAAACATTCATTCACAAAACTCAAAACAGAGAAGTTCTTGGGCCCTTTTATCTCCAACAACAGTACACCACAGATTCAAGATTTTCTATATTAGAAAAAGGAGGAAATGAAATGAATGGGTGTCCGGAAATTGGGAATTAA...

CDS

Download CDS FASTA

882 bp · TkA06G123350|TK1151|CDS

ATGAGTCTGGAGCCAGGTGAAGATATGGAGTTCCTCAAAAGAGAATTCATGGAAGTCATCAAAGGCTTAATTTGTTTACCCATCAAACTCCCTGGTTTTAGAATGTATAAATCTCTCCAGGCTAAAGAAAGAATGTTAAAGATGGTGAGAAAGATTGTAGATGATAGGAAAACGGCAATGGAGAAAAAAGAAACAAAAGATTCATGTTCACCAAATGATGCCATTGATGTGCTTCTAAGGGATACAGGTGAATCAGATCA...

Protein

Download Protein FASTA

293 aa · TkA06G123350|TK1151|PROTEIN

MSLEPGEDMEFLKREFMEVIKGLICLPIKLPGFRMYKSLQAKERMLKMVRKIVDDRKTAMEKKETKDSCSPNDAIDVLLRDTGESDQGLPLDFISGNIIEMMIPGEDSVPMIMTLAVKYLSDNPSALACLRDENDELKKRKDESGEGYAWTDYVSLPFTQGVISETLRMANIINAIWRKALEDVEIKGYLIPKGWCVLASLTSVHMDEENYENPDEFDPWRWEKTGANVNSNKFTPFGGGQRLCPGLEFSRLEISIFLHH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G123350`
TK1151 ID	TkA06G123350
OH-1004 ID	LXL04_024625
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 59.073 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G123350

Location Chr06:32131438-32136983 (-)

Description Similar to CYP90C1: 3-epi-6-deoxocathasterone 23-monooxygenase CYP90C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36380`	Involved in brassinosteroid (BR) biosynthesis.	Changes in the shapes of leaves and flowers upon overexpression of cytochrome P450 in Arabidopsis.1999 · DOI: 10.1073/pnas.96.16.9433 CYP90C1 and CYP90D1 are involved in different steps in the brassinosteroid biosynthesis pathway in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2004.02330.x C-23 hydroxylation by Arabidopsis CYP90C1 and CYP90D1 reveals a novel shortcut in brassinosteroid biosynthesis.2006 · DOI: 10.1105/tpc.106.045443 The ROTUNDIFOLIA3 gene of Arabidopsis thaliana encodes a new member of the cytochrome P-450 family that is required for the regulated polar elongation of leaf cells.1998 · DOI: 10.1101/gad.12.15.2381
`At3g13730`	Involved in brassinosteroid (BR) biosynthesis.	CYP90C1 and CYP90D1 are involved in different steps in the brassinosteroid biosynthesis pathway in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2004.02330.x C-23 hydroxylation by Arabidopsis CYP90C1 and CYP90D1 reveals a novel shortcut in brassinosteroid biosynthesis.2006 · DOI: 10.1105/tpc.106.045443

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0197100`	Catalyzes the C6-oxidation step in brassinosteroids biosynthesis.	A rice brassinosteroid-deficient mutant, ebisu dwarf (d2), is caused by a loss of function of a new member of cytochrome P450.2003 · DOI: 10.1105/tpc.014712
`UniProt: A2WLP4`	Catalyzes the C6-oxidation step in brassinosteroids biosynthesis (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024625 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009965 leaf morphogenesis Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0016132 brassinosteroid biosynthetic process Biological Process

GO:0042814 monopolar cell growth Biological Process

GO:0048366 leaf development Biological Process

GO:0048441 petal development Biological Process

GO:0048443 stamen development Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G13730

ath:AT4G36380

bdi:100839691

dosa:Os01g0197100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.899

Rank 1 · TkA06G123350 · TK1151

Cytoplasm0.045

Rank 2 · TkA06G123350 · TK1151

Plastid0.032

Rank 3 · TkA06G123350 · TK1151

Cell membrane0.030

Rank 4 · TkA06G123350 · TK1151

Nucleus0.030

Rank 5 · TkA06G123350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45040-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G123350	`PF00067`	p450	40	273	1.3e-47	163.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M066`	Arabidopsis thaliana	sp\|Q9M066\|C90C1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase CYP90C1	67.600%	Swiss-Prot	High
`Q94IA6`	Arabidopsis thaliana	sp\|Q94IA6\|C90D1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase CYP90D1	54.900%	Swiss-Prot	High
`Q94IW5`	Oryza sativa subsp. japonica	sp\|Q94IW5\|C90D2_ORYSJ Cytochrome P450 90D2	54.100%	Swiss-Prot	High
`A2WLP4`	Oryza sativa subsp. indica	sp\|A2WLP4\|C90D2_ORYSI Cytochrome P450 90D2	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card