TkA06G121870 | RubberDandelionOmics

Gene overview

TkA06G121870

Reference: TK1151 Chr: Chr06 Coordinates: 31766676-31772948 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2196 bp · TkA06G121870|TK1151|cDNA

CAAAGGTGGTAGTTATTTCAAGTTGCCCGTCACAATGTCAACGTTAATGCAGACGAAGAAACGTGCTGCCGGAGCACTGTTCGCGCTGGCCTTAAACCATGTCCAGATCCACCAGACTCGTCCTGTCGGCAATGCAATCGCCGCCGATTCCTTCTCCAACGATCGCCGCCTTTGGGTCCATGAGTCCTCCGGTCTGCTCCGCCCTATTTTCAGGATCCTGGATATTGAAAGTGCAGCCTGGCATGATCTGGAAACAACTG...

CDS

Download CDS FASTA

1950 bp · TkA06G121870|TK1151|CDS

ATGTCAACGTTAATGCAGACGAAGAAACGTGCTGCCGGAGCACTGTTCGCGCTGGCCTTAAACCATGTCCAGATCCACCAGACTCGTCCTGTCGGCAATGCAATCGCCGCCGATTCCTTCTCCAACGATCGCCGCCTTTGGGTCCATGAGTCCTCCGGTCTGCTCCGCCCTATTTTCAGGATCCTGGATATTGAAAGTGCAGCCTGGCATGATCTGGAAACAACTGCCATCAGTTCTAATATCAGGCCTCATGTTGGATC...

Protein

Download Protein FASTA

649 aa · TkA06G121870|TK1151|PROTEIN

MSTLMQTKKRAAGALFALALNHVQIHQTRPVGNAIAADSFSNDRRLWVHESSGLLRPIFRILDIESAAWHDLETTAISSNIRPHVGSFLKVLAEENDGASKEVSEQELALAKAVDAMVSNLETSPEHFEHKKAKHRVYAHEWREKFSVKESMAETKEHLQKKEEKDCKSPRPEQVPAASNREVQEKSFEEVGMIGNQRKVAVLYELLWACLADTPTEDDKKYKSRPQKGYDARHRAALRLLTTWFDLKWIKMEAIEVVIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G121870`
TK1151 ID	TkA06G121870
OH-1004 ID	LXL04_024637
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 87.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G121870

Location Chr06:31766676-31772948 (+)

Description Similar to Tmco4: Transmembrane and coiled-coil domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0112800`	Involved in anther lipids biosynthesis and is required for tapetum degradation and pollen wall formation.	SWOLLEN TAPETUM AND STERILITY 1 is required for tapetum degeneration and pollen wall formation in rice.2022 · DOI: 10.1093/plphys/kiac307 OsLDDT1, encoding a transmembrane structural DUF726 family protein, is essential for tapetum degradation and pollen formation in rice.2023 · DOI: 10.1016/j.plantsci.2023.111596

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024637 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010208 pollen wall assembly Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0052689 carboxylic ester hydrolase activity Molecular Function

KEGG gene cross-reference

cel:CELE_F35D11.3

dosa:Os03g0112800

hsa:255104

mmu:77056

rno:500573

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.303

Rank 1 · TkA06G121870 · TK1151

Cytoplasm0.226

Rank 2 · TkA06G121870 · TK1151

Endoplasmic reticulum0.189

Rank 3 · TkA06G121870 · TK1151

Cell membrane0.178

Rank 4 · TkA06G121870 · TK1151

Nucleus0.126

Rank 5 · TkA06G121870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12697Abhydrolase_654-107 aa

PF09422AMER94-201 aa

PF05277DUF726285-631 aa

PF12697Abhydrolase_6335-370 aa

PF12697Abhydrolase_6502-553 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G121870	`PF12697`	Abhydrolase_6	54	107	3.0	9.1
TkA06G121870	`PF09422`	AMER	94	201	0.46	10.4
TkA06G121870	`PF05277`	DUF726	285	631	1e-100	337.8
TkA06G121870	`PF12697`	Abhydrolase_6	335	370	3.0	9.1
TkA06G121870	`PF12697`	Abhydrolase_6	502	553	3.0	9.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10SS2`	Oryza sativa subsp. japonica	sp\|Q10SS2\|STS1_ORYSJ Transmembrane and coiled-coil domain-containing protein STS1	56.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card