TkA06G121690 | RubberDandelionOmics

Gene overview

TkA06G121690

Reference: TK1151 Chr: Chr06 Coordinates: 31715364-31718773 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1922 bp · TkA06G121690|TK1151|cDNA

TCCGGTCTAAGCAAACCCGGATAAGAACTAACAAGTAGTCAAGTACCGTTGAATTGGGACTCCCCAAAACACCGCAAGAGGACTTGGAAGAACGTACGAAGTCACCCACAGACAGTAGACCTAGGCACCTAGCATCTGATAACACCCACAAAAAGGCGCCAAATTGCTTAATTTTTAGCAAGTCGGAATACTAGGATCGGACTGCAAATTAGAGAGGTACCGAGAAAAAATATGAGAGCGTTACTGCCTTTTCTTGGGTC...

CDS

Download CDS FASTA

1434 bp · TkA06G121690|TK1151|CDS

ATGAGAGCGTTACTGCCTTTTCTTGGGTCACTGTTGATAATTAATGTATGTAATGGGTTGTTAACTTCTCGACTCGATCATTTGAGTAGCAACAGCAGCAGTTATCTGACCAAGGAAGCTTTGTGGTTGAATCAGACTCTCGATCACTTTTCCCCCTATGATGATCGTAAATTTCAACAGCGGTACTATGAATACTTGGATGAATTCAGGATTCCTGGTGGACCGATCTTCTTAGTAATATCTGGTGAATCTGAATGTCG...

Protein

Download Protein FASTA

477 aa · TkA06G121690|TK1151|PROTEIN

MRALLPFLGSLLIINVCNGLLTSRLDHLSSNSSSYLTKEALWLNQTLDHFSPYDDRKFQQRYYEYLDEFRIPGGPIFLVISGESECRGITNDYIGVLAKKFGAAVVTLEHRYYGKSSPFKTFTTKNLKFLSSKQALFDLAAFRQFYQESINLKLNRTNIENPWFVFGISYAGALSAWFRLKFPHLTCGSLASSGVVHPILNYYQYDQQMGESAGPECKAILQEVTQLVEKRLPSDGESLKTKFGAAALHIDADFMYFLAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G121690`
TK1151 ID	TkA06G121690
OH-1004 ID	LXL04_024642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G121690

Location Chr06:31715364-31718773 (+)

Description Similar to EDA2: Probable serine protease EDA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18080`	May be involved in a proteolytic pathway controlling the nuclear division phase of megagametogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024642 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005768 endosome Cellular Component

GO:0045121 membrane raft Cellular Component

GO:0008236 serine-type peptidase activity Molecular Function

GO:0008239 dipeptidyl-peptidase activity Molecular Function

GO:0070008 serine-type exopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18080

cel:CELE_F56F10.1

cel:CELE_K12H4.7

hsa:10279

mmu:54373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.557

Rank 1 · TkA06G121690 · TK1151

Extracellular0.194

Rank 2 · TkA06G121690 · TK1151

Cytoplasm0.141

Rank 3 · TkA06G121690 · TK1151

Endoplasmic reticulum0.133

Rank 4 · TkA06G121690 · TK1151

Cell membrane0.100

Rank 5 · TkA06G121690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05577Peptidase_S2845-427 aa

PF00561Abhydrolase_197-184 aa

PF00561Abhydrolase_1421-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G121690	`PF05577`	Peptidase_S28	45	427	1.8e-71	241.9
TkA06G121690	`PF00561`	Abhydrolase_1	97	184	0.0016	18.9
TkA06G121690	`PF00561`	Abhydrolase_1	421	434	0.0016	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PF50`	Arabidopsis thaliana	sp\|Q1PF50\|EDA2_ARATH Probable serine protease EDA2	60.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card