TkA06G121280 | RubberDandelionOmics

Gene overview

TkA06G121280

Reference: TK1151 Chr: Chr06 Coordinates: 31587894-31590064 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1215 bp · TkA06G121280|TK1151|cDNA

TTACTCCAAAACTTAATCAGGCGAGCTCAAATTACGCGAAAATAGAATATAAAAAGACCGCGGTCATAACGTGTCAAGGACAAGGCAAGCCAAAAGGAGATACCAGGGGGGATCTTCAAGACTTCAACATTTTCACACACATTCGCCGGCGTATACTCTACGCCGGCCCCGCCAAAATTTCACTTTTCTGTAAAATGTAGGTGGCAAACTAAACGGAGAAGCACAACAACCACAAAGAAAAAGTCCAAAATCAGCTGTAT...

CDS

Download CDS FASTA

687 bp · TkA06G121280|TK1151|CDS

ATGGACCACAACCACTTAACCATTAAGACATTCATGGCGATAATGGCGGAACGTGACGCAGCCATCCAAGAGCGCAACCTCGCTCTAGACGAACGAAAACGCGCGTTCGCCGAACGCGACATGGCGATGCTACAGCGCGACGCCGCCCTAGCGGAACGCAACTCCGCCATGCAACAACGCGATGAAGCAATCTCCACCCTCCGTTTCCAAATCTCAACAACCCCCGTAACCACCCCAACAACCCAACAAGACCTCCACCA...

Protein

Download Protein FASTA

228 aa · TkA06G121280|TK1151|PROTEIN

MDHNHLTIKTFMAIMAERDAAIQERNLALDERKRAFAERDMAMLQRDAALAERNSAMQQRDEAISTLRFQISTTPVTTPTTQQDLHHHMFEITPTTQQTHHMLEFPENPKPKGVRVPKGGRRRGESVKMEWKDEMAVPVCSCTGVAQPCYRWGSGGWQSACCTTTMSMYPLPQVSNKKYSRIGGRKMSGGAFSKLLTRLSEEGYDLSTPLDLKEHWAKHGTNRYTTVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G121280`
TK1151 ID	TkA06G121280
OH-1004 ID	LXL04_024646
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 73.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G121280

Location Chr06:31587894-31590064 (-)

Description Similar to BPC4: Protein BASIC PENTACYSTEINE4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21240`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At5g42520`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At4g38910`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At1g68120`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0130600`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009723 response to ethylene Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G21240

ath:AT4G38910

ath:AT5G42520

dosa:Os06g0130600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.832

Rank 1 · TkA06G121280 · TK1151

Cytoplasm0.238

Rank 2 · TkA06G121280 · TK1151

Mitochondrion0.040

Rank 3 · TkA06G121280 · TK1151

Cell membrane0.032

Rank 4 · TkA06G121280 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA06G121280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06217GAGA_bind9-108 aa

PF28733PII1_coiled_coil9-74 aa

PF30679CCDC18_2nd15-70 aa

PF24568CC_PcsB18-39 aa

PF24568CC_PcsB43-68 aa

PF06217GAGA_bind134-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G121280	`PF06217`	GAGA_bind	9	108	6.6e-74	250.4
TkA06G121280	`PF28733`	PII1_coiled_coil	9	74	0.033	13.3
TkA06G121280	`PF30679`	CCDC18_2nd	15	70	0.021	13.7
TkA06G121280	`PF24568`	CC_PcsB	18	39	0.85	10.2
TkA06G121280	`PF24568`	CC_PcsB	43	68	0.85	10.2
TkA06G121280	`PF06217`	GAGA_bind	134	228	6.6e-74	250.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8C6`	Arabidopsis thaliana	sp\|Q8S8C6\|BPC4_ARATH Protein BASIC PENTACYSTEINE4	70.200%	Swiss-Prot	Low
`Q8L999`	Arabidopsis thaliana	sp\|Q8L999\|BPC6_ARATH Protein BASIC PENTACYSTEINE6	70.500%	Swiss-Prot	Low
`F4JUI3`	Arabidopsis thaliana	sp\|F4JUI3\|BPC5_ARATH Protein BASIC PENTACYSTEINE5	67.000%	Swiss-Prot	Low
`Q9C9X6`	Arabidopsis thaliana	sp\|Q9C9X6\|BPC3_ARATH Protein BASIC PENTACYSTEINE3	63.800%	Swiss-Prot	Low
`Q5VSA8`	Oryza sativa subsp. japonica	sp\|Q5VSA8\|BBRD_ORYSJ Barley B recombinant-like protein D	60.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card