TkA06G119760 | RubberDandelionOmics

Gene overview

TkA06G119760

Reference: TK1151 Chr: Chr06 Coordinates: 31299403-31305046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1071 bp · TkA06G119760|TK1151|CDS

ATGGCACCTGCATCAATGAAATGGGACCAGAACTCGTTGCTTGAAAAAAACTTCATTCGTGACGATGATGAACGGCCGAAGGTACCGTATAATAAGTTCAGCAACGAGATTCCTGTAATTTCACTCGAAGGTATCGATGATTTGGAAAGAAGGGCGGAGATTTGTGAGAAGATCGTGAAAGCCTGTGAGGAGTGGGGGATGTTTCAGGTGGTGGATCATGGCGTCGACGGAAAACTGCTGTCGGAGATGAATAGGCTGTC...

Protein

Download Protein FASTA

356 aa · TkA06G119760|TK1151|PROTEIN

MAPASMKWDQNSLLEKNFIRDDDERPKVPYNKFSNEIPVISLEGIDDLERRAEICEKIVKACEEWGMFQVVDHGVDGKLLSEMNRLSREFFQMPEEEKLEFDMTGGKKGGFLVSSHLQGETVQNWREFVTYFSYPIRARDYSRWPNKPKEWRAVTEEYSEMLMGLGCKLLEVLSEAMGLEKDALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITIEPIEGAIVVNLGDHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G119760`
TK1151 ID	TkA06G119760
OH-1004 ID	LXL04_024659
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G119760

Location Chr06:31299403-31305046 (-)

Description Similar to FHT: Naringenin,2-oxoglutarate 3-dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51240`	Catalyzes the 3-beta-hydroxylation of 2S-flavanones to 2R,3R-dihydroflavonols which are intermediates in the biosynthesis of flavonols, anthocyanidins, catechins and proanthocyanidins in plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0045486 flavanone 3-dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.772

Rank 1 · TkA06G119760 · TK1151

Nucleus0.329

Rank 2 · TkA06G119760 · TK1151

Mitochondrion0.059

Rank 3 · TkA06G119760 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA06G119760 · TK1151

Peroxisome0.050

Rank 5 · TkA06G119760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N37-146 aa

PF031712OG-FeII_Oxy66-93 aa

PF031712OG-FeII_Oxy192-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G119760	`PF14226`	DIOX_N	37	146	9.6e-24	85.0
TkA06G119760	`PF03171`	2OG-FeII_Oxy	66	93	3.9e-32	111.3
TkA06G119760	`PF03171`	2OG-FeII_Oxy	192	292	3.9e-32	111.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S818`	Arabidopsis thaliana	sp\|Q9S818\|FL3H_ARATH Naringenin,2-oxoglutarate 3-dioxygenase	73.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card