RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G119610
Reference: TK1151 Chr: Chr06 Coordinates: 31252146-31268142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2335 bp · TkA06G119610|TK1151|cDNA

CTTTGGAGGGCATCAAACGGTTTCTTTTCTTCATGCCACCGGAAAAGACACCTAAAGAGGGAGCAGTTAACATAAAAATCAATGAGGAGGGGGTCCTCATTTTTCTTCTTCTTCAACGCGAAAAAAGTCTCGTTGACCACCGTCACCACCACCCCCTCCTCCACCATATATTTTTATAATTCCACATTACTTGCATTTTCTTGATTTCTTCGGTCTTCCTCATTCGTATTTATTAACCTACCCATAACCCATTATGTTCT...

CDS

Download CDS FASTA

1653 bp · TkA06G119610|TK1151|CDS

ATGGGTATCTGTTTTTCGACAACCAAGATCAGCGGCTCCGACAGCATCGCTCCCTCCCTTAACGACGGCGCCTCCACCACCGCCGGCGAAAACCAACAAAAGCATCTCGTCTTGAAACAGGATGGACGTGGGTATAATGGTAAATTACCCAAAACGAGAGATTCCAATAGGAGTGCATATCAAAAGCAGGGTTTCAACAATAGTAAAACTAATCCGAAAGGTAAGTCGACGCCAAAGCGTCAAAAAGGGTTGATTCCTTG...

Protein

Download Protein FASTA

550 aa · TkA06G119610|TK1151|PROTEIN

MGICFSTTKISGSDSIAPSLNDGASTTAGENQQKHLVLKQDGRGYNGKLPKTRDSNRSAYQKQGFNNSKTNPKGKSTPKRQKGLIPCGKRTDFGYLKDFDRRYSTGKLLGHGQFGYTYVAVDKANGDRVAVKKIDKAKMVLPIAVEDVKREVKILRALSGHENVVQFHNAFEDDSFVYIVMELCKGGELLDRILSKKEGRYTEKDAAIVVRQMLKVAAECHLHGLVHRDMKPENFLFKSPNEDSHLKATDFGLSDFIRPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G119610
TK1151 IDTkA06G119610
OH-1004 IDLXL04_024660
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G119610
LocationChr06:31252146-31268142 (-)
DescriptionSimilar to CPK28: Calcium-dependent protein kinase 28
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g66210 May play a role in signal transduction pathways that involve calcium as a second messenger (Probable).
Function of calcium-dependent protein kinase CPK28 of Arabidopsis thaliana in plant stem elongation and vascular development.2013 · DOI: 10.1111/tpj.12090
The calcium-dependent protein kinase CPK28 buffers plant immunity and regulates BIK1 turnover.2014 · DOI: 10.1016/j.chom.2014.10.007
Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
At2g17890 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
At4g36070 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0409900 May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).
A rice calcium-dependent protein kinase is expressed in cortical root cells during the presymbiotic phase of the arbuscular mycorrhizal symbiosis.2011 · DOI: 10.1186/1471-2229-11-90
Rice small C2-domain proteins are phosphorylated by calcium-dependent protein kinase.2013 · DOI: 10.1007/s10059-013-2185-0
Direct phosphorylation and activation of a mitogen-activated protein kinase by a calcium-dependent protein kinase in rice.2014 · DOI: 10.1105/tpc.114.126441
Os02g0126400 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024660 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006952 defense response Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0051592 response to calcium ion Biological Process
GO:1900425 negative regulation of defense response to bacterium Biological Process
GO:2000032 regulation of secondary shoot formation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT2G17890
ath:AT4G36070
ath:AT5G66210
dosa:Os02g0126400
dosa:Os07g0409900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.510
Rank 1 · TkA06G119610 · TK1151
Cytoplasm0.288
Rank 2 · TkA06G119610 · TK1151
Nucleus0.206
Rank 3 · TkA06G119610 · TK1151
Endoplasmic reticulum0.064
Rank 4 · TkA06G119610 · TK1151
Golgi apparatus0.063
Rank 5 · TkA06G119610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09248DUF196544-83 aa
PF14531Kinase-like97-163 aa
PF00069Pkinase103-363 aa
PF07714PK_Tyr_Ser-Thr106-352 aa
PF03109ABC1118-133 aa
PF01636APH128-196 aa
PF25578EF-hand_STIM1159-174 aa
PF03109ABC1178-259 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G119610PF09248DUF196544830.07313.5
TkA06G119610PF14531Kinase-like971634.9e-0626.7
TkA06G119610PF00069Pkinase1033635.3e-69233.3
TkA06G119610PF07714PK_Tyr_Ser-Thr1063522.2e-2796.7
TkA06G119610PF03109ABC11181330.000221.3
TkA06G119610PF01636APH1281960.02715.0
TkA06G119610PF25578EF-hand_STIM11591741.59.7
TkA06G119610PF03109ABC11782590.000221.3
TkA06G119610PF06293Kdo1782520.007316.5
TkA06G119610PF14531Kinase-like1873134.9e-0626.7
TkA06G119610PF00404Dockerin_11982130.0002122.1
TkA06G119610PF01636APH2232420.02715.0
TkA06G119610PF29176Allatotropin-like_C3163261.6e-0628.3
TkA06G119610PF23564EF-hand_FSTL14044697.9e-0627.0
TkA06G119610PF12763EH4054780.1213.0
TkA06G119610PF30624EF_SSP1204064306.4e-0627.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FKW4Arabidopsis thalianasp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 2883.200%Swiss-ProtHigh
Q7XJR9Arabidopsis thalianasp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 1679.600%Swiss-ProtHigh
Q1PE17Arabidopsis thalianasp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 1875.800%Swiss-ProtHigh
Q0D715Oryza sativa subsp. japonicasp|Q0D715|CDPKI_ORYSJ Calcium-dependent protein kinase 1877.900%Swiss-ProtHigh
Q6Z2M9Oryza sativa subsp. japonicasp|Q6Z2M9|CDPK4_ORYSJ Calcium-dependent protein kinase 476.000%Swiss-ProtHigh

JBrowse

View in Genome Browser