TkA06G118160 | RubberDandelionOmics

Gene overview

TkA06G118160

Reference: TK1151 Chr: Chr06 Coordinates: 30931073-30938331 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3259 bp · TkA06G118160|TK1151|cDNA

AAAACCAATGTTTATTGCAGGGTACCCCACTAAATTAATGACAAAAAAGTTGTTCATATTGGCATTATATGCGCATTACATTATATACCTGAACTTAGAAGATACAGCAAGCGGATTTGGATAGATCATATACAGATGATATCAGTTAGGGTTTACTGAATATGAAGAAAAAGATGTCTGATTTGTTGAAAATTTCCAATTTTTCATGGGTATTTGCAGTTTGTGCTCTTCTTTCTTCTGAATTGATTTCTGGGTATCAA...

CDS

Download CDS FASTA

3012 bp · TkA06G118160|TK1151|CDS

ATGAAGAAAAAGATGTCTGATTTGTTGAAAATTTCCAATTTTTCATGGGTATTTGCAGTTTGTGCTCTTCTTTCTTCTGAATTGATTTCTGGGTATCAAACTGGAAGTGGCATTGTTAAGGGGAAATTGAATGTTCACTTAGTTCCACATTCTCATGATGATGTCGGTTGGTTGAAGACAGTTGATCAGTATTTTATTGGGTCCAATAACAGCATACAGGGTGCTTGTGTTGAGAATGTGCTGGATTCGGTTGTCATGTC...

Protein

Download Protein FASTA

1003 aa · TkA06G118160|TK1151|PROTEIN

MKKKMSDLLKISNFSWVFAVCALLSSELISGYQTGSGIVKGKLNVHLVPHSHDDVGWLKTVDQYFIGSNNSIQGACVENVLDSVVMSLLRDPNRKFIFAEMAFFQRWWKSQSKKIKAVVKKLVAAGQLEFVNGGWCMHDEAATHYIDMIDQTTLGHGLIKDNFNVTPRAGWQIDPFGHSAVQAYLLGAELGFDSMHFARIDYQDRAKRKGDKSLEVIWRGSKTFGESSQIFTNAFPKHYSAPEGFNFEVSGDFEPVQDNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G118160`
TK1151 ID	TkA06G118160
OH-1004 ID	LXL04_024671
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G118160

Location Chr06:30931073-30938331 (-)

Description Similar to Alpha-mannosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66150`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release
`At5g13980`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release
`At3g26720`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024671 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006013 mannose metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043202 lysosomal lumen Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004559 alpha-mannosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT3G26720

ath:AT5G13980

ath:AT5G66150

cpoc:100718205

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.317

Rank 1 · TkA06G118160 · TK1151

Extracellular0.315

Rank 2 · TkA06G118160 · TK1151

Endoplasmic reticulum0.151

Rank 3 · TkA06G118160 · TK1151

Cell membrane0.139

Rank 4 · TkA06G118160 · TK1151

Cytoplasm0.123

Rank 5 · TkA06G118160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01074Glyco_hydro_38N42-356 aa

PF09261Alpha-mann_mid360-452 aa

PF21260Laman-like_dom555-578 aa

PF07748Glyco_hydro_38C603-813 aa

PF17677Glyco_hydro38C2895-999 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G118160	`PF01074`	Glyco_hydro_38N	42	356	1.5e-89	300.7
TkA06G118160	`PF09261`	Alpha-mann_mid	360	452	6.7e-19	68.5
TkA06G118160	`PF21260`	Laman-like_dom	555	578	9e-07	29.7
TkA06G118160	`PF07748`	Glyco_hydro_38C	603	813	2e-44	153.0
TkA06G118160	`PF17677`	Glyco_hydro38C2	895	999	3e-09	37.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKW9`	Arabidopsis thaliana	sp\|Q9FKW9\|MANA3_ARATH Probable alpha-mannosidase At5g66150	63.900%	Swiss-Prot	High
`Q8LPJ3`	Arabidopsis thaliana	sp\|Q8LPJ3\|MANA2_ARATH Probable alpha-mannosidase At5g13980	60.400%	Swiss-Prot	High
`P94078`	Arabidopsis thaliana	sp\|P94078\|MANA1_ARATH Alpha-mannosidase At3g26720	58.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card