TkA06G117960 | RubberDandelionOmics

Gene overview

TkA06G117960

Reference: TK1151 Chr: Chr06 Coordinates: 30873082-30875152 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1922 bp · TkA06G117960|TK1151|cDNA

CGTCTCTCCCCCCTTCCTCCTCCATCTCTTTCTTTATCTCTCTCCCTCAAACCCTCCGCCGTATCTCTCTTTCTCTCTAACAGTCCCTTTATCACTTTCTGCAACTCCACATATCTTCCAATAAAAATTCATCTTTTTGTAACATATCAATTTAATCAAAGATGATGCAAGATATGTGGAATGCTCCGCCAGGGTTTAGACCCACTAAATCCGCCCCCTCGTCACCGGCCAAGCCTCTTACAGGTGGGGTTTTAAGGACT...

CDS

Download CDS FASTA

702 bp · TkA06G117960|TK1151|CDS

ATGTGTAATTTGGGGATTTGTTTGATGAAACAAGGGAGACTAGGTGAAGCGAAGGAGACGCTCCGGTTAGTGAAACCGGCGGTGGTGGATGGGCCGCGAGGGGTGGATTCGCATCTGAAAGCGTACGAAAGAGCGCAGCAGATGTTACGTGATTTGGAATCGGAGATGATGAATAGCGGCGGCGATAGAGTTGAACAGAGGAAACTGTTCGACGCTTTCTTGGGATCTTCCGCACTTTGGCAACCTCAGCCTTGTAAAGA...

Protein

Download Protein FASTA

233 aa · TkA06G117960|TK1151|PROTEIN

MCNLGICLMKQGRLGEAKETLRLVKPAVVDGPRGVDSHLKAYERAQQMLRDLESEMMNSGGDRVEQRKLFDAFLGSSALWQPQPCKEHVSSSLPVSNQTKTKDTFADENKKPVGIGNNNNNNNSLSLNIDAKPFYVKGGENAAEGLKRTRSVNEVAELEGGKARRRSGSPEKNDWSGLLPDSKDFEEAIIAAVLGSTTEPEKMKTDIGKVVGRKIEKRLKVFQDITPSLSPRA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G117960`
TK1151 ID	TkA06G117960
OH-1004 ID	LXL04_024674
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 49.156 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G117960

Location Chr06:30873082-30875152 (-)

Description Similar to At3g51280: Protein POLLENLESS 3-LIKE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51280`	Probably involved in the regulation of cell division.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024674 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006792 regulation of sulfur utilization Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010438 cellular response to sulfur starvation Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0017053 transcription repressor complex Cellular Component

KEGG gene cross-reference

ath:AT1G04770

ath:AT3G51280

ath:AT4G20900

ath:AT5G44330

ath:AT5G48850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484

Rank 1 · TkA06G117960 · TK1151

Cytoplasm0.311

Rank 2 · TkA06G117960 · TK1151

Cell membrane0.201

Rank 3 · TkA06G117960 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA06G117960 · TK1151

Golgi apparatus0.055

Rank 5 · TkA06G117960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515TPR_12-19 aa

PF07719TPR_22-21 aa

PF13181TPR_82-22 aa

PF14559TPR_194-32 aa

PF00515TPR_139-47 aa

PF14559TPR_1939-52 aa

PF07719TPR_239-47 aa

PF13181TPR_839-50 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G117960	`PF00515`	TPR_1	2	19	0.0091	16.5
TkA06G117960	`PF07719`	TPR_2	2	21	0.016	16.0
TkA06G117960	`PF13181`	TPR_8	2	22	0.089	13.7
TkA06G117960	`PF14559`	TPR_19	4	32	0.0098	16.9
TkA06G117960	`PF00515`	TPR_1	39	47	0.0091	16.5
TkA06G117960	`PF14559`	TPR_19	39	52	0.0098	16.9
TkA06G117960	`PF07719`	TPR_2	39	47	0.016	16.0
TkA06G117960	`PF13181`	TPR_8	39	50	0.089	13.7
TkA06G117960	`PF00515`	TPR_1	183	189	0.0091	16.5
TkA06G117960	`PF07719`	TPR_2	183	190	0.016	16.0
TkA06G117960	`PF13181`	TPR_8	183	190	0.089	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD20`	Arabidopsis thaliana	sp\|Q9SD20\|MS5L2_ARATH Protein POLLENLESS 3-LIKE 2	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card