TkA06G117370 | RubberDandelionOmics

Gene overview

TkA06G117370

Reference: TK1151 Chr: Chr06 Coordinates: 30730899-30732823 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1217 bp · TkA06G117370|TK1151|cDNA

ATTATGATATAAAGGTTAGTTTTTATAAATAGTTAAAACCCGTAAGGACCTGTTGTGGAATATTTTAGGACGAATAGACTTCACCGCCCGGGCATCTGTTGCTGTTCAATGGAAGAGGACAGCAGCGATGGCGACGGCGGTTCAACGGAAACTCCGACAACGGAAGGTATGACCACCGTATCTCATCACTATTTCGGAGATTCAAATGGCTCCGAAGATGCTGTCTCCATCACAATCATCGAGAGCATGAAAGAAGACTA...

CDS

Download CDS FASTA

705 bp · TkA06G117370|TK1151|CDS

ATGGAAGAGGACAGCAGCGATGGCGACGGCGGTTCAACGGAAACTCCGACAACGGAAGGTATGACCACCGTATCTCATCACTATTTCGGAGATTCAAATGGCTCCGAAGATGCTGTCTCCATCACAATCATCGAGAGCATGAAAGAAGACTACGGCTTGTTCGTGTGGCCGTGTAGTGTCATCCTGGCGGAGTACGTGTGGCAACAAAGATCTCGCTTTACTGGAATCAGCGTGGTCGAGCTTGGGGCCGGTACATCACT...

Protein

Download Protein FASTA

234 aa · TkA06G117370|TK1151|PROTEIN

MEEDSSDGDGGSTETPTTEGMTTVSHHYFGDSNGSEDAVSITIIESMKEDYGLFVWPCSVILAEYVWQQRSRFTGISVVELGAGTSLPGLVAAKVGADVILTDDSTRLEVLENMRRVCELNNVKCEVMGLTWGVWDESIFSLQPQVILGADVLYDSSAFDNLFATVKFLLENSPKSVFITSYHNRSGHHLIEFLMVKWQLKCVKLLDGFSFLPSWKASGLSGNIQLVEIGLRDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G117370`
TK1151 ID	TkA06G117370
OH-1004 ID	LXL04_024688
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G117370`
Location	Chr06:30730899-30732823 (-)
Description	Similar to mettl23: Methyltransferase-like protein 23
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024688` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0018022 peptidyl-lysine methylation Biological Process GO:0032259 methylation Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0044725 epigenetic programming in the zygotic pronuclei Biological Process GO:0044727 epigenetic programing of male pronucleus Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	hsa:124512 mmu:100504608 mmu:74319 rno:287918 xla:444818 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.547

Rank 1 · TkA06G117370 · TK1151

Cytoplasm0.475

Rank 2 · TkA06G117370 · TK1151

Cell membrane0.062

Rank 3 · TkA06G117370 · TK1151

Lysosome / Vacuole0.056

Rank 4 · TkA06G117370 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA06G117370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_1637-186 aa

PF21595CCL2-like63-106 aa

PF27753Cramped_PI3K_like185-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G117370	`PF10294`	Methyltransf_16	37	186	2e-23	83.7
TkA06G117370	`PF21595`	CCL2-like	63	106	0.25	12.1
TkA06G117370	`PF27753`	Cramped_PI3K_like	185	207	0.19	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card