TkA06G115670 | RubberDandelionOmics

Gene overview

TkA06G115670

Reference: TK1151 Chr: Chr06 Coordinates: 30272348-30275609 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2068 bp · TkA06G115670|TK1151|cDNA

ATCTATACAAAATTTAAATAAATAATAGAACCAATATCATCACCTTTCAATCCTCCTCTTCTCTTCTGTCATGCTAATCTCACTGCCCACTTTCCAATCCTCATTGAAACTCCTTAACCACCATGAGAAACCACCATTCAAACTCCCTTCAAGATTCTCCATAACAAATTCCCAGAATCACGATTGCCAGTTTTCAACATTTTTTCAGGCAAACCAGAGTAGTGTTGCAGCAGTGGTGTTTGGGGAAGCGTCAACACGGT...

CDS

Download CDS FASTA

1428 bp · TkA06G115670|TK1151|CDS

ATGCTAATCTCACTGCCCACTTTCCAATCCTCATTGAAACTCCTTAACCACCATGAGAAACCACCATTCAAACTCCCTTCAAGATTCTCCATAACAAATTCCCAGAATCACGATTGCCAGTTTTCAACATTTTTTCAGGCAAACCAGAGTAGTGTTGCAGCAGTGGTGTTTGGGGAAGCGTCAACACGGTCAAGATTGTATCCATTGACCAAAAGAAGATCAGAAGGTGCAATTCCGATTGCAGGAAGTTATAGGCTTAT...

Protein

Download Protein FASTA

475 aa · TkA06G115670|TK1151|PROTEIN

MLISLPTFQSSLKLLNHHEKPPFKLPSRFSITNSQNHDCQFSTFFQANQSSVAAVVFGEASTRSRLYPLTKRRSEGAIPIAGSYRLIDAVISNCINSNITKIYALTQFNSTSLNSHLLRAYSGGLLANQEFLEVIAAYQSPEDNGWFQGTADAMRRCLWVLEKHPALEFLVLPGHHLYKMDYQKLLEEHRNNKADITVAVLDNMRDHKTGFGSFKIDINDRVIGFREEQELFMPSSVHGSKFNNDDKFSSMGIYVMNRHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G115670`
TK1151 ID	TkA06G115670
OH-1004 ID	LXL04_024711
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G115670

Location Chr06:30272348-30275609 (+)

Description Similar to APS2: Inactive glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05610`	Inactive glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic.	No verified direct reference in this release
`At5g48300`	This protein plays a role in synthesis of starch.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024711 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010170 glucose-1-phosphate adenylyltransferase complex Cellular Component

GO:0030931 heterotetrameric ADPG pyrophosphorylase complex Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008878 glucose-1-phosphate adenylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05610

ath:AT5G48300

bna:106366674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.911

Rank 1 · TkA06G115670 · TK1151

Mitochondrion0.082

Rank 2 · TkA06G115670 · TK1151

Cytoplasm0.074

Rank 3 · TkA06G115670 · TK1151

Peroxisome0.043

Rank 4 · TkA06G115670 · TK1151

Nucleus0.039

Rank 5 · TkA06G115670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483NTP_transferase64-317 aa

PF25247LbH_GLGC337-474 aa

PF25087GMPPB_C346-392 aa

PF24894Hexapep_GlmU347-389 aa

PF00132Hexapep350-361 aa

PF25084LbH_EIF2B352-388 aa

PF00132Hexapep367-390 aa

PF24894Hexapep_GlmU414-439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G115670	`PF00483`	NTP_transferase	64	317	4.6e-40	138.4
TkA06G115670	`PF25247`	LbH_GLGC	337	474	2.6e-45	154.4
TkA06G115670	`PF25087`	GMPPB_C	346	392	3.7e-06	27.4
TkA06G115670	`PF24894`	Hexapep_GlmU	347	389	1.2e-08	35.7
TkA06G115670	`PF00132`	Hexapep	350	361	1.1e-05	25.6
TkA06G115670	`PF25084`	LbH_EIF2B	352	388	3.6e-06	27.6
TkA06G115670	`PF00132`	Hexapep	367	390	1.1e-05	25.6
TkA06G115670	`PF24894`	Hexapep_GlmU	414	439	1.2e-08	35.7
TkA06G115670	`PF25084`	LbH_EIF2B	415	460	3.6e-06	27.6
TkA06G115670	`PF25087`	GMPPB_C	415	440	3.7e-06	27.4
TkA06G115670	`PF00132`	Hexapep	415	438	1.1e-05	25.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I8U2`	Arabidopsis thaliana	sp\|F4I8U2\|APS2L_ARATH Inactive glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic	53.300%	Swiss-Prot	High
`P55228`	Arabidopsis thaliana	sp\|P55228\|GLGS_ARATH Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card