TkA06G111660 | RubberDandelionOmics

Gene overview

TkA06G111660

Reference: TK1151 Chr: Chr06 Coordinates: 29290363-29294354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2124 bp · TkA06G111660|TK1151|cDNA

ACAAGTTCACGAAAGTACAGTCTAAGTCATCGCACTTAGCATCCGCATCTGACCCTTACTAGATTACTTCTCTGTGTAAAACTAAAAGCGACCGACACAACAGAGCCGGGCTTCCCCTTCATCGTTGCTGCCCAATTTTTTTTCTTTCTGTGTTGCTTGCACATTACAAGTATAATTTAAGAAGGATTTGGCCGATTGAACTGACAATTTGATCAGTGGCCCCAAGCGGAGAAAACTCTTGGAGATGATCTGCGTGAAAG...

CDS

Download CDS FASTA

1635 bp · TkA06G111660|TK1151|CDS

ATGTTTTCTCAATATATAAATAAAATTCAAGGGATTTTGGAGCCACAAAGAACGGTTGGATCCATGGATCTGGAAAGTGACAGACTAAGCAGCTTGCCAGATGATCTTATCCATAAAATCCTTTCTTTTATTTACATCGAAGATGCTATCAGAACGAGTTATTTGTCAAGTAGATGGAGATATATCTGGACTTTAACGCCCAACCTGAATTTCGAAAATCTGAATCGTGGGTCCCGCATCTCCAAATTCTTCTCTAGTGT...

Protein

Download Protein FASTA

544 aa · TkA06G111660|TK1151|PROTEIN

MFSQYINKIQGILEPQRTVGSMDLESDRLSSLPDDLIHKILSFIYIEDAIRTSYLSSRWRYIWTLTPNLNFENLNRGSRISKFFSSVLSHRNNQTQICSINLVLGATVMDNECITQILNCAFAHNVQQLSITRSRAKIVGRPLFYGLSSIPTPTWDLRALTTLHLHFIQLSDDNFFSKYTNLKNLSLRKCSLIKGKKVLNICLPRLSNLSLEYLRPGIELVEHVNVVAPQLENLSIKYCDGKQLISAPRLITLVIEGYHP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G111660`
TK1151 ID	TkA06G111660
OH-1004 ID	LXL04_024759
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G111660

Location Chr06:29290363-29294354 (-)

Description Similar to At5g56420: F-box/FBD/LRR-repeat protein At5g56420

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At5g56820`	Putative FBD-associated F-box protein At5g56820.	No verified direct reference in this release
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At3g49480`	Putative F-box/FBD/LRR-repeat protein At3g49480.	No verified direct reference in this release
`At1g32020`	Putative F-box protein At1g32020.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024759 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G28410

ath:AT5G02920

ath:AT5G02930

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.761

Rank 1 · TkA06G111660 · TK1151

Cytoplasm0.258

Rank 2 · TkA06G111660 · TK1151

Cell membrane0.064

Rank 3 · TkA06G111660 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA06G111660 · TK1151

Mitochondrion0.026

Rank 5 · TkA06G111660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box29-65 aa

PF12937F-box-like29-62 aa

PF24758LRR_At5g56370118-255 aa

PF12799LRR_4147-176 aa

PF12799LRR_4180-211 aa

PF12799LRR_4263-277 aa

PF24758LRR_At5g56370265-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G111660	`PF00646`	F-box	29	65	2.1e-06	28.1
TkA06G111660	`PF12937`	F-box-like	29	62	0.0063	17.0
TkA06G111660	`PF24758`	LRR_At5g56370	118	255	0.0015	18.9
TkA06G111660	`PF12799`	LRR_4	147	176	0.17	12.9
TkA06G111660	`PF12799`	LRR_4	180	211	0.17	12.9
TkA06G111660	`PF12799`	LRR_4	263	277	0.17	12.9
TkA06G111660	`PF24758`	LRR_At5g56370	265	292	0.0015	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	28.800%	Swiss-Prot	Low
`Q9FJT1`	Arabidopsis thaliana	sp\|Q9FJT1\|FBD29_ARATH Putative FBD-associated F-box protein At5g56820	55.300%	Swiss-Prot	Low
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	25.800%	Swiss-Prot	Low
`Q9CA04`	Arabidopsis thaliana	sp\|Q9CA04\|FDL45_ARATH Putative F-box/FBD/LRR-repeat protein At3g49480	53.300%	Swiss-Prot	Low
`Q9C6W9`	Arabidopsis thaliana	sp\|Q9C6W9\|FB28_ARATH Putative F-box protein At1g32020	46.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card