TkA06G109940 | RubberDandelionOmics

Gene overview

TkA06G109940

Reference: TK1151 Chr: Chr06 Coordinates: 28939272-28940758 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1126 bp · TkA06G109940|TK1151|cDNA

TACCGTGTTGCTTGCACATTACAAGTATAATATAAGAAGGCTTTGGCCGATTGAACTAACAATTTGATCAGTAGCCCCAAGCGGAGGAAGCTCTTGGAGATGATCTACGTGAAAGAATAAAAGGAATTTTTTTCAATATATAAATAAAATGTAAGGGATTTTGGAGCCAAAAAGAATGGTAGGATCAATGGATGTGGAAAGTGACAGACTAAGCAGCTTGCCAGATGATCTTATCCATAAAATCCTTTCTTTTATCTACA...

CDS

Download CDS FASTA

951 bp · TkA06G109940|TK1151|CDS

ATGGTAGGATCAATGGATGTGGAAAGTGACAGACTAAGCAGCTTGCCAGATGATCTTATCCATAAAATCCTTTCTTTTATCTACATCAAAGATGCTATCAGACCCAATATTTTGTCAAGTAGATGGAGATATATCTGGACTTCAAGCCCCAACCTGAATTTCGAAAATCTGAATCGCGGGTCCCGCATCTCCAAATTCTTCTCTAGTGTTCTGTCTCACCGCAATAATCAAACACAAATTTGTTCCATCAATCTTGTTCT...

Protein

Download Protein FASTA

317 aa · TkA06G109940|TK1151|PROTEIN

MVGSMDVESDRLSSLPDDLIHKILSFIYIKDAIRPNILSSRWRYIWTSSPNLNFENLNRGSRISKFFSSVLSHRNNQTQICSINLVLGATVMDNECITQILNCAFAHNVQQLSITRSRAKNVGRPLFYGLSSIPTPTWDLRALTTLHLNFIQLSDDNFFSKYTNLKNLSLRKCTLMKGRKVLNICLPRLSNLSLEYLRPDIELVEHVNVVAPQLENLSIKYCDGKQVIYAPRLATLVIEGCHPWEISTPGFPSSEKVDLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G109940`
TK1151 ID	TkA06G109940
OH-1004 ID	LXL04_024776
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 94.637 / OH-1004 86.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G109940

Location Chr06:28939272-28940758 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At1g32020`	Putative F-box protein At1g32020.	No verified direct reference in this release
`At3g49480`	Putative F-box/FBD/LRR-repeat protein At3g49480.	No verified direct reference in this release
`At3g58960`	Putative F-box protein At3g58960.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024776 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G49030

ath:AT5G02920

ath:AT5G02930

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.830

Rank 1 · TkA06G109940 · TK1151

Cytoplasm0.206

Rank 2 · TkA06G109940 · TK1151

Cell membrane0.041

Rank 3 · TkA06G109940 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA06G109940 · TK1151

Plastid0.016

Rank 5 · TkA06G109940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_85-21 aa

PF00646F-box12-51 aa

PF12937F-box-like12-45 aa

PF00646F-box54-73 aa

PF00646F-box94-102 aa

PF24758LRR_At5g56370101-239 aa

PF13855LRR_8108-132 aa

PF12799LRR_4130-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G109940	`PF13855`	LRR_8	5	21	0.25	11.8
TkA06G109940	`PF00646`	F-box	12	51	0.00079	20.0
TkA06G109940	`PF12937`	F-box-like	12	45	0.077	13.5
TkA06G109940	`PF00646`	F-box	54	73	0.00079	20.0
TkA06G109940	`PF00646`	F-box	94	102	0.00079	20.0
TkA06G109940	`PF24758`	LRR_At5g56370	101	239	0.0014	19.1
TkA06G109940	`PF13855`	LRR_8	108	132	0.25	11.8
TkA06G109940	`PF12799`	LRR_4	130	159	0.1	13.6
TkA06G109940	`PF13855`	LRR_8	145	195	0.25	11.8
TkA06G109940	`PF12799`	LRR_4	163	194	0.1	13.6
TkA06G109940	`PF17840`	Tugs	188	195	2.5	9.0
TkA06G109940	`PF12799`	LRR_4	212	219	0.1	13.6
TkA06G109940	`PF13855`	LRR_8	231	244	0.25	11.8
TkA06G109940	`PF17840`	Tugs	268	296	2.5	9.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	31.500%	Swiss-Prot	Medium
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	25.800%	Swiss-Prot	Low
`Q9C6W9`	Arabidopsis thaliana	sp\|Q9C6W9\|FB28_ARATH Putative F-box protein At1g32020	44.000%	Swiss-Prot	Low
`Q9CA04`	Arabidopsis thaliana	sp\|Q9CA04\|FDL45_ARATH Putative F-box/FBD/LRR-repeat protein At3g49480	53.300%	Swiss-Prot	Low
`Q9LYU0`	Arabidopsis thaliana	sp\|Q9LYU0\|FB210_ARATH Putative F-box protein At3g58960	44.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card