TkA06G109760 | RubberDandelionOmics

Gene overview

TkA06G109760

Reference: TK1151 Chr: Chr06 Coordinates: 28883762-28888267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2351 bp · TkA06G109760|TK1151|cDNA

CTGACCCTTACTAGATTACTTCTCTGTGTAAAACTAAAAGCGACCGACACAACAGAGCCGGGCTTCCCCTTCATCGTTGCTGCCCAATTTTTTTTTCTTTCTGGTTTGTCTTCCCTATCTCTCAATCCCTCGTTCTCTTATGAGTATTTATAGTTCCAACCCAGATTTTATTTTAATTTTAATTTTATAATCTAATTAATGATTTGTGAATATGAATTGCAACTGCGAAATTGTTTGCATAGGTTTATAACTTTATTATC...

CDS

Download CDS FASTA

1095 bp · TkA06G109760|TK1151|CDS

ATGTTTTCTCAATATATAAATAAAATTCAAGGGATTTTGGAGCCACAAAGAACGGTTGGATCCATGGATCTGGAAAGTGACAGACTAAGCAGCTTGCCAGATGATCTTATCCATAAAATCCTTTCTTTTATCTATATCGAAGATGTTATCAGAACCAGTATTTTGTCCAGTAGATGGAGATATATCTGGACTTTAACGCCCAACCTGAATTTCGAAAATCTCAACCGCGGGTCCCGCATCTCCAAATTCTTCTCTAGTGT...

Protein

Download Protein FASTA

364 aa · TkA06G109760|TK1151|PROTEIN

MFSQYINKIQGILEPQRTVGSMDLESDRLSSLPDDLIHKILSFIYIEDVIRTSILSSRWRYIWTLTPNLNFENLNRGSRISKFFSSVLSHRNNQTQICSINLVLGATVMDNECITQILNCAFAHNVQQLSITRSRAKIVGRPLFYGLSSIPTPTWDLRALTTLHLHFIQLSDDNFFSKYTNLKNPSLRKCTLMKGRKVLNICLPRLSNLSLEYLRPGIELVEHVNVVAPQLENLSIKYCDGKQLISAPRLITLVIEGYHP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G109760`
TK1151 ID	TkA06G109760
OH-1004 ID	LXL04_024776
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.780 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G109760

Location Chr06:28883762-28888267 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At1g32020`	Putative F-box protein At1g32020.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024776 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G49030

ath:AT5G02920

ath:AT5G02930

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.833

Rank 1 · TkA06G109760 · TK1151

Cytoplasm0.197

Rank 2 · TkA06G109760 · TK1151

Cell membrane0.045

Rank 3 · TkA06G109760 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA06G109760 · TK1151

Mitochondrion0.016

Rank 5 · TkA06G109760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box29-65 aa

PF12937F-box-like29-62 aa

PF00646F-box111-119 aa

PF25701RRM_YTH1119-137 aa

PF12799LRR_4147-176 aa

PF12799LRR_4199-211 aa

PF25701RRM_YTH1218-234 aa

PF12799LRR_4263-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G109760	`PF00646`	F-box	29	65	2e-06	28.2
TkA06G109760	`PF12937`	F-box-like	29	62	0.00099	19.5
TkA06G109760	`PF00646`	F-box	111	119	2e-06	28.2
TkA06G109760	`PF25701`	RRM_YTH1	119	137	0.42	11.2
TkA06G109760	`PF12799`	LRR_4	147	176	0.18	12.8
TkA06G109760	`PF12799`	LRR_4	199	211	0.18	12.8
TkA06G109760	`PF25701`	RRM_YTH1	218	234	0.42	11.2
TkA06G109760	`PF12799`	LRR_4	263	278	0.18	12.8
TkA06G109760	`PF25701`	RRM_YTH1	310	338	0.42	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	30.600%	Swiss-Prot	Medium
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	31.800%	Swiss-Prot	Medium
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	32.000%	Swiss-Prot	Medium
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	30.900%	Swiss-Prot	Low
`Q9C6W9`	Arabidopsis thaliana	sp\|Q9C6W9\|FB28_ARATH Putative F-box protein At1g32020	46.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card