RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G109330
Reference: TK1151 Chr: Chr06 Coordinates: 28777725-28781987 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3208 bp · TkA06G109330|TK1151|cDNA

TCAAAAAAGTTACAATTAAATATAGATAAAACAATAACTAACCTTATAAATTATTATCGGATAAATGATAAGTGTAGAGAAAAAACTGTCATGTAAGCCTACGAGAGATGTTTGCTAGCTATAAAGAGCAGATGTTAATATCGAATAAACTAAATAATACTCACCTAGTCTCTCTCTCCATTGATTACACGCTTTATCTTTGATTTTAATTTGTGGAAAATAGGAATTTAATTTTTATAATCGGAAGGTCCGTACTCTGA...

CDS

Download CDS FASTA

2193 bp · TkA06G109330|TK1151|CDS

ATGAAGCTTTCAACATCAGGCGCTGGTCAGCAGCCTCAAGAAGGAGAGAAGAAAAGCTTGAATTCGGAGCTATGGCATGCTTGTGCAGGCCCTCTTGTTTCCCTACCGACAGTAGGGTCTCGAGTAATCTATTTCCCTCAAGGTCATAGTGAGCAGGTGGCCGCTACAACAAATAAAGAAATCGATTCTCACATACCCAACTACCCAAGCCTCCCTCCCCAATTGATCTGCCAACTCCACAATGTCACAATGCATGCAGA...

Protein

Download Protein FASTA

730 aa · TkA06G109330|TK1151|PROTEIN

MKLSTSGAGQQPQEGEKKSLNSELWHACAGPLVSLPTVGSRVIYFPQGHSEQVAATTNKEIDSHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTFLPVELGIPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRSSRSQTVMPSSVLSSDSMHIGLLAAAAHAAATN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G109330
TK1151 IDTkA06G109330
OH-1004 IDLXL04_024778
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G109330
LocationChr06:28777725-28781987 (+)
DescriptionSimilar to ARF8: Auxin response factor 8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g37020 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Auxin response factors ARF6 and ARF8 promote jasmonic acid production and flower maturation.2005 · DOI: 10.1242/dev.01955
AUXIN RESPONSE FACTOR8 is a negative regulator of fruit initiation in Arabidopsis.2006 · DOI: 10.1105/tpc.105.037192
At1g30330 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Auxin response factors ARF6 and ARF8 promote jasmonic acid production and flower maturation.2005 · DOI: 10.1242/dev.01955

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q258Y5 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Os04g0671900 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
UniProt: A2X1A1 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009908 flower development Biological Process
GO:0010154 fruit development Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference
ath:AT1G30330
ath:AT5G37020
dosa:Os06g0677800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951
Rank 1 · TkA06G109330 · TK1151
Cytoplasm0.111
Rank 2 · TkA06G109330 · TK1151
Cell membrane0.031
Rank 3 · TkA06G109330 · TK1151
Endoplasmic reticulum0.023
Rank 4 · TkA06G109330 · TK1151
Plastid0.017
Rank 5 · TkA06G109330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25313BRWD_AD35-64 aa
PF13580SIS_239-112 aa
PF09217EcoRII-N124-158 aa
PF02362B3127-228 aa
PF31239At5g26805_C182-222 aa
PF02362B3234-258 aa
PF25313BRWD_AD250-359 aa
PF06507ARF_AD276-359 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G109330PF25313BRWD_AD35649.8e-1039.4
TkA06G109330PF13580SIS_2391120.1512.8
TkA06G109330PF09217EcoRII-N1241580.1113.0
TkA06G109330PF02362B31272281.9e-2383.0
TkA06G109330PF31239At5g26805_C1822220.1413.4
TkA06G109330PF02362B32342581.9e-2383.0
TkA06G109330PF25313BRWD_AD2503599.8e-1039.4
TkA06G109330PF06507ARF_AD2763596.1e-34116.5
TkA06G109330PF31239At5g26805_C4424640.1413.4
TkA06G109330PF02309AUX_IAA4544733.8e-1040.6
TkA06G109330PF02309AUX_IAA6077063.8e-1040.6
TkA06G109330PF02362B36556901.9e-2383.0
TkA06G109330PF09217EcoRII-N6907160.1113.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FGV1Arabidopsis thalianasp|Q9FGV1|ARFH_ARATH Auxin response factor 861.300%Swiss-ProtHigh
Q9ZTX8Arabidopsis thalianasp|Q9ZTX8|ARFF_ARATH Auxin response factor 654.200%Swiss-ProtHigh
Q258Y5Oryza sativa subsp. indicasp|Q258Y5|ARFL_ORYSI Auxin response factor 1259.200%Swiss-ProtHigh
Q0J951Oryza sativa subsp. japonicasp|Q0J951|ARFL_ORYSJ Auxin response factor 1259.100%Swiss-ProtHigh
A2X1A1Oryza sativa subsp. indicasp|A2X1A1|ARFF_ORYSI Auxin response factor 654.500%Swiss-ProtHigh

JBrowse

View in Genome Browser