TkA06G108890 | RubberDandelionOmics

Gene overview

TkA06G108890

Reference: TK1151 Chr: Chr06 Coordinates: 28686185-28688622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · TkA06G108890|TK1151|cDNA

GTTCATGGTGGTTCCTGAGCAACAGAGTGCGATTCACCTCGAAATCTCCTGTGCTCGATTCCACTCCGGAATACTTAAGGAGCACCAACGGGCAACACTATCGTCTTAGAGATACTTCGCATTTCCTCCCCTAATTTAACGAGTTAGATCAACGACAGAACATTCCTTCCTTCAATATAGAGCTGTATCCGTCATACAAAACACACGAAACCAAGTATGACGCCCGTTTCATCTAAGCACTACTCAGATGATGTAAGCTT...

CDS

Download CDS FASTA

846 bp · TkA06G108890|TK1151|CDS

ATGACGCCCGTTTCATCTAAGCACTACTCAGATGATGTAAGCTTGCTAATGGTTCTAATCGACACAAATCCATTGTTCTGGAGCTCAACCGGCACCCCTTTCTCATTCTCCAAGTTCCTATCTCAAGTTCTTTCGTTCTTGAACTCAATCATTCTACTAAACCAACTGAATCAAGTGGTGGTGATAGCAACCGGATTCAACTCTTGTGATTACATATACGATTCTTCATTAGGGCATGGAAAACAGAGAGCTGAGACATT...

Protein

Download Protein FASTA

281 aa · TkA06G108890|TK1151|PROTEIN

MTPVSSKHYSDDVSLLMVLIDTNPLFWSSTGTPFSFSKFLSQVLSFLNSIILLNQLNQVVVIATGFNSCDYIYDSSLGHGKQRAETLLQKLEEFVVRDEKLNKEESVDGIGSSLLSGSLSMALCYIQRVFRSGSLHPQPRILCLHGSQDGPGQYVAIMNSIFSAQRSMVPIDSCVIGSQHSAFLQQASYITGGVYLKPQHLDGLFQYLSTVFAADLHSRSFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIFCQHH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G108890`
TK1151 ID	TkA06G108890
OH-1004 ID	LXL04_024784
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G108890

Location Chr06:28686185-28688622 (+)

Description Similar to TFB4: General transcription and DNA repair factor IIH subunit TFB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18340`	Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024784 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0000438 core TFIIH complex portion of holo TFIIH complex Cellular Component

GO:0000439 transcription factor TFIIH core complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

GO:0005675 transcription factor TFIIH holo complex Cellular Component

GO:0097550 transcription preinitiation complex Cellular Component

KEGG gene cross-reference

ath:AT1G18340

bta:511896

hsa:2967

mmu:209357

rno:288651

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.606

Rank 1 · TkA06G108890 · TK1151

Cytoplasm0.391

Rank 2 · TkA06G108890 · TK1151

Golgi apparatus0.099

Rank 3 · TkA06G108890 · TK1151

Lysosome / Vacuole0.098

Rank 4 · TkA06G108890 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA06G108890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03850Tfb413-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G108890	`PF03850`	Tfb4	13	267	5.2e-92	309.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LF41`	Arabidopsis thaliana	sp\|Q8LF41\|TFB4_ARATH General transcription and DNA repair factor IIH subunit TFB4	73.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card