RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G108840
Reference: TK1151 Chr: Chr06 Coordinates: 28669326-28672529 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1826 bp · TkA06G108840|TK1151|cDNA

CGACTCCCTCAATTGATTAGACCATATACGAATGTCGCATACTATTCTCCAAAGTCGACTCGCAATCGCTTTAAACATCAAGTGCGAAGAATCTCCGGAGGAACTACGGCATACATGGTTTGGGGCCTCTTTCCCGCCGACCCCCTTCCAGGGGAAGAAACTTATTACTTCTTCAGCAAAGGGACATATAAAGTGGGGCGAAAAGGATGTGATATAATTGTAAATAAAGATAAAGGGGTTTCAAGGATCCATGCAGAAAT...

CDS

Download CDS FASTA

1674 bp · TkA06G108840|TK1151|CDS

CGACTCCCTCAATTGATTAGACCATATACGAATGTCGCATACTATTCTCCAAAGTCGACTCGCAATCGCTTTAAACATCAAGTGCGAAGAATCTCCGGAGGAACTACGGCATACATGGTTTGGGGCCTCTTTCCCGCCGACCCCCTTCCAGGGGAAGAAACTTATTACTTCTTCAGCAAAGGGACATATAAAGTGGGGCGAAAAGGATGTGATATAATTGTAAATAAAGATAAAGGGGTTTCAAGGATCCATGCAGAAAT...

Protein

Download Protein FASTA

557 aa · TkA06G108840|TK1151|PROTEIN

RLPQLIRPYTNVAYYSPKSTRNRFKHQVRRISGGTTAYMVWGLFPADPLPGEETYYFFSKGTYKVGRKGCDIIVNKDKGVSRIHAEIIIDAMISIDNLKKKSSVKSSKIRIKDCSKYGTFITKSLGSKEKVHEFPNKETTMDDGDLVSFGTGNATYRFDFISIVFLLCGFDSFRSKELEEKISSIGAFVSNTWSQKCTHVVLGDNASVNSDLIDAIISKRHFVSYKWIESLADKRIDTKIPSCSSDASSLMLEGVSVKIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G108840
TK1151 IDTkA06G108840
OH-1004 IDLXL04_015618
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)49.200
Protein coverage (%)TK1151 74.327 / OH-1004 99.286
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G108840
LocationChr06:28669326-28672529 (-)
DescriptionSimilar to NBS1: Nijmegen breakage syndrome 1 protein
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02680 Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.
NBS1 is involved in DNA repair and plays a synergistic role with ATM in mediating meiotic homologous recombination in plants.2007 · DOI: 10.1111/j.1365-313x.2007.03220.x

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0487300 Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. No verified direct reference in this release
UniProt: B8BHK8 Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015618 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006312 mitotic recombination Biological Process
GO:0006974 DNA damage response Biological Process
GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process
GO:0007131 reciprocal meiotic recombination Biological Process
GO:0071479 cellular response to ionizing radiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005694 chromosome Cellular Component
GO:0030870 Mre11 complex Cellular Component
GO:0003684 damaged DNA binding Molecular Function
KEGG gene cross-reference
ath:AT3G02680
dosa:Os10g0487300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.910
Rank 1 · TkA06G108840 · TK1151
Cytoplasm0.185
Rank 2 · TkA06G108840 · TK1151
Cell membrane0.025
Rank 3 · TkA06G108840 · TK1151
Mitochondrion0.020
Rank 4 · TkA06G108840 · TK1151
Endoplasmic reticulum0.010
Rank 5 · TkA06G108840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16697Yop-YscD_cpl59-101 aa
PF00498FHA63-150 aa
PF00533BRCT95-111 aa
PF28593YdgU156-169 aa
PF00533BRCT163-229 aa
PF12738PTCB-BRCT168-203 aa
PF00498FHA201-223 aa
PF16697Yop-YscD_cpl249-269 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G108840PF16697Yop-YscD_cpl591010.1113.6
TkA06G108840PF00498FHA631501.9e-0835.3
TkA06G108840PF00533BRCT951113.7e-1247.0
TkA06G108840PF28593YdgU1561690.311.6
TkA06G108840PF00533BRCT1632293.7e-1247.0
TkA06G108840PF12738PTCB-BRCT1682030.0002621.6
TkA06G108840PF00498FHA2012231.9e-0835.3
TkA06G108840PF16697Yop-YscD_cpl2492690.1113.6
TkA06G108840PF00498FHA2562801.9e-0835.3
TkA06G108840PF00533BRCT2662993.7e-1247.0
TkA06G108840PF12738PTCB-BRCT2852990.0002621.6
TkA06G108840PF11711Tim543715230.1311.8
TkA06G108840PF08599Nbs1_C4805370.09713.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q0H8D7Arabidopsis thalianasp|Q0H8D7|NBS1_ARATH Nibrin homolog41.000%Swiss-ProtMedium
Q7XD82Oryza sativa subsp. japonicasp|Q7XD82|NBS1_ORYSJ Nibrin homolog35.500%Swiss-ProtMedium
B8BHK8Oryza sativa subsp. indicasp|B8BHK8|NBS1_ORYSI Nibrin homolog35.200%Swiss-ProtMedium

JBrowse

View in Genome Browser