TkA06G106990 | RubberDandelionOmics

Gene overview

TkA06G106990

Reference: TK1151 Chr: Chr06 Coordinates: 28210744-28212997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1669 bp · TkA06G106990|TK1151|cDNA

CTTAAATCATAATTTCGGCCACTGTCGCGGATCCTGATACGCAAAGAACCCCCTCCCTTGACTCTCTTTGCCTGTGCTCGGTTATCCTAGATTCTGGAGTCATTCATCATCTTAAGGGTTCAGTGAATGGCGAACAGAGCCTCCCAAAATTGAGTTAGCAAGAGAAATTGAGAAACTTGCCAGCTCAATCAGAAGCCCCTGGTCGGACTGAAGATTGCTCGAACATCAAGTCATACAATGGAATCCTGAACTTGCTCAAA...

CDS

Download CDS FASTA

1176 bp · TkA06G106990|TK1151|CDS

ATGAAAAGTAAAACTTGGAGATGGGTTTTAGGGCTAATTTACATACTTGCAGTTGCAACAATTTGGATAGCCGCTAGTTTTGTAGTTCAATCAGTAGTTGATGGAGGTGTTTCACCTTTTCTCGTCACATATATATGCAATTCATTGTTTGTAATATACATTCCGTTGGTAGAAATCGGGCGTTATCTGGAAGATAACTATTCAAATTTACTATTTTGGAGAAGTAAAGATGATAGTATTAGTATTAGTAACCCACCAAG...

Protein

Download Protein FASTA

391 aa · TkA06G106990|TK1151|PROTEIN

MKSKTWRWVLGLIYILAVATIWIAASFVVQSVVDGGVSPFLVTYICNSLFVIYIPLVEIGRYLEDNYSNLLFWRSKDDSISISNPPRTQDSEVVNLLVEKHIGTVTEEAVNNDDDDVSLETTVVSSQHATCEQLDSKGRWTRKRLAKVSLLICPFWFLAQLSFNLSLKYTSVTSNTILSSSSSLFTFLVSLAFLGEKFTWIKLASVLLCMGGTIIVSLGDSETGTSAIASNPTLGDILALISSAFYAVYITLIRKNLPDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G106990`
TK1151 ID	TkA06G106990
OH-1004 ID	LXL04_024807
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G106990`
Location	Chr06:28210744-28212997 (-)
Description	Similar to SLC35F5: Solute carrier family 35 member F5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024807` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015871 choline transport Biological Process GO:0016020 membrane Cellular Component GO:0015220 choline transmembrane transporter activity Molecular Function
KEGG gene cross-reference	bta:615480 hsa:80255 mmu:74150 pon:100173522 sce:YML018C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.431

Rank 1 · TkA06G106990 · TK1151

Cell membrane0.203

Rank 2 · TkA06G106990 · TK1151

Endoplasmic reticulum0.184

Rank 3 · TkA06G106990 · TK1151

Golgi apparatus0.136

Rank 4 · TkA06G106990 · TK1151

Cytoplasm0.103

Rank 5 · TkA06G106990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06027SLC35F9-68 aa

PF00892EamA10-61 aa

PF16913PUNUT131-255 aa

PF00892EamA149-217 aa

PF03151TPT155-295 aa

PF08449UAA156-247 aa

PF06027SLC35F167-292 aa

PF00892EamA234-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G106990	`PF06027`	SLC35F	9	68	3.1e-11	44.1
TkA06G106990	`PF00892`	EamA	10	61	2.1e-12	48.2
TkA06G106990	`PF16913`	PUNUT	131	255	9.2e-08	32.4
TkA06G106990	`PF00892`	EamA	149	217	2.1e-12	48.2
TkA06G106990	`PF03151`	TPT	155	295	4.2e-06	27.1
TkA06G106990	`PF08449`	UAA	156	247	5.1e-06	26.6
TkA06G106990	`PF06027`	SLC35F	167	292	3.1e-11	44.1
TkA06G106990	`PF00892`	EamA	234	293	2.1e-12	48.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card