TkA06G106120 | RubberDandelionOmics

Gene overview

TkA06G106120

Reference: TK1151 Chr: Chr06 Coordinates: 28039675-28044622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3441 bp · TkA06G106120|TK1151|cDNA

CGGTTTTCAAGTGATTTTTCCCTAAAATGGAAGCTTATACAGTGGGGGTAAAGAAGAGTCGGCACGTGCGATTTGGGTATTAGTAAACAACAACAGTACACCACTTTTTCTTCTGCACGACATACGAAGAAGCCAAGAATTTGTCATGATGAAACTATACACACACCAACGACAAGAACCAAAGAAGAAATCAAAACCCATTCATCCCAAAATCTTTCTTCCTTCTCTCTCTAAAACCCTTCTTCTATTATCAATCCCTG...

CDS

Download CDS FASTA

2868 bp · TkA06G106120|TK1151|CDS

ATGGGTGAAAGATTATTGTCAGTCACTCCCTCTGATAGAGCTCTTGAACAGGCGATCGTGGCTTTAAAGAAAGGGGCATATATATTGAAGTATGGCCGAAGAGGGAAGCCGAAATTATGCCCCTTCAGACTATCAACGGATGAAAGAACTTTAATGTGGTTTTCCGGCAATGAAGAAAAACAACTTCAGCTAAGCTCCGTTAGGAACCTTGTTCGTGGCCATGGGACTAGGAAACTTCAACCAGAAAGAGAATGTCATTC...

Protein

Download Protein FASTA

955 aa · TkA06G106120|TK1151|PROTEIN

MGERLLSVTPSDRALEQAIVALKKGAYILKYGRRGKPKLCPFRLSTDERTLMWFSGNEEKQLQLSSVRNLVRGHGTRKLQPERECHSFSLIYMNNQAQCSLDLICKDKLQADSWFLGLKALISRCRELGHSENRRGAQSCVNSPSSFLRRKCNMGLSKETTKMSQVRSVCGSPIPESISDRCFSDGLSYSSDSFYSRSSLSSTQNFTENLPPYSPCMKSEEPKKNKNPKSVSRFSTQTTLEVQPNPKRTKLSDVLIWGEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G106120`
TK1151 ID	TkA06G106120
OH-1004 ID	LXL04_024813
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G106120

Location Chr06:28039675-28044622 (+)

Description Similar to PRAF1: PH, RCC1 and FYVE domains-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76950`	Binds to phosphatidic acid and to phosphoinositides such as PtdIns3P, PtdIns(3,4)P(2), PtdIns(3,4,5)P(3) and PtdIns(4,5)P(2).	No verified direct reference in this release
`At5g63860`	UV-B specific signaling component that acts as a UV-B photoreceptor and plays a key role in establishing UV-protective responses in plants.	A UV-B-specific signaling component orchestrates plant UV protection.2005 · DOI: 10.1073/pnas.0507187102 UV-B promotes rapid nuclear translocation of the Arabidopsis UV-B specific signaling component UVR8 and activates its function in the nucleus.2007 · DOI: 10.1105/tpc.107.053330 UV-B signaling pathways with different fluence-rate response profiles are distinguished in mature Arabidopsis leaf tissue by requirement for UVR8, HY5, and HYH.2008 · DOI: 10.1104/pp.107.108456 Interaction of COP1 and UVR8 regulates UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2009 · DOI: 10.1038/emboj.2009.4 UVR8 in Arabidopsis thaliana regulates multiple aspects of cellular differentiation during leaf development in response to ultraviolet B radiation.2009 · DOI: 10.1111/j.1469-8137.2009.02855.x Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2010 · DOI: 10.1073/pnas.0914532107 Functional interaction of the circadian clock and UV RESISTANCE LOCUS 8-controlled UV-B signaling pathways in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04573.x Perception of UV-B by the Arabidopsis UVR8 protein.2011 · DOI: 10.1126/science.1200660 UVR8 mediates UV-B-induced Arabidopsis defense responses against Botrytis cinerea by controlling sinapate accumulation.2012 · DOI: 10.1093/mp/sss025 C-terminal region of the UV-B photoreceptor UVR8 initiates signaling through interaction with the COP1 protein.2012 · DOI: 10.1073/pnas.1210898109 In vivo function of tryptophans in the Arabidopsis UV-B photoreceptor UVR8.2012 · DOI: 10.1105/tpc.112.101451 The UV-B photoreceptor UVR8 promotes photosynthetic efficiency in Arabidopsis thaliana exposed to elevated levels of UV-B.2012 · DOI: 10.1007/s11120-012-9785-y

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010374 stomatal complex development Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0035091 phosphatidylinositol binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0070300 phosphatidic acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G76950

hsa:8925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · TkA06G106120 · TK1151

Nucleus0.317

Rank 2 · TkA06G106120 · TK1151

Cell membrane0.244

Rank 3 · TkA06G106120 · TK1151

Golgi apparatus0.059

Rank 4 · TkA06G106120 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA06G106120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16457PH_1216-122 aa

PF25390WD40_RLD253-628 aa

PF00415RCC1254-316 aa

PF25384Alsin_RLD304-376 aa

PF13540RCC1_2307-332 aa

PF00415RCC1320-364 aa

PF13540RCC1_2351-379 aa

PF00415RCC1367-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G106120	`PF16457`	PH_12	16	122	1.4e-07	32.7
TkA06G106120	`PF25390`	WD40_RLD	253	628	1e-73	249.5
TkA06G106120	`PF00415`	RCC1	254	316	1.6e-66	221.4
TkA06G106120	`PF25384`	Alsin_RLD	304	376	3.5e-12	46.9
TkA06G106120	`PF13540`	RCC1_2	307	332	1.7e-30	104.7
TkA06G106120	`PF00415`	RCC1	320	364	1.6e-66	221.4
TkA06G106120	`PF13540`	RCC1_2	351	379	1.7e-30	104.7
TkA06G106120	`PF00415`	RCC1	367	411	1.6e-66	221.4
TkA06G106120	`PF13540`	RCC1_2	398	426	1.7e-30	104.7
TkA06G106120	`PF00415`	RCC1	415	463	1.6e-66	221.4
TkA06G106120	`PF25384`	Alsin_RLD	415	492	3.5e-12	46.9
TkA06G106120	`PF13540`	RCC1_2	450	463	1.7e-30	104.7
TkA06G106120	`PF00415`	RCC1	478	525	1.6e-66	221.4
TkA06G106120	`PF13540`	RCC1_2	478	489	1.7e-30	104.7
TkA06G106120	`PF25384`	Alsin_RLD	479	545	3.5e-12	46.9
TkA06G106120	`PF13540`	RCC1_2	513	542	1.7e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q947D2`	Arabidopsis thaliana	sp\|Q947D2\|PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1	34.000%	Swiss-Prot	Medium
`Q9FN03`	Arabidopsis thaliana	sp\|Q9FN03\|UVR8_ARATH Ultraviolet-B receptor UVR8	27.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card