TkA06G105850 | RubberDandelionOmics

Gene overview

TkA06G105850

Reference: TK1151 Chr: Chr06 Coordinates: 27994592-27997542 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkA06G105850|TK1151|cDNA

TTGTAATTAGGCAAAACTGTAAGGTTCGAATATCGTACAGATTAAAGATGATATTACGGTTTGCACCCCTGAATTGATTTTAACCAAAACTTGACGGAATCGATTTGGTGATCGCCGACGAATCAAGGAAAGCGATAACTGAGATGCAAGGAGGAGAAAAAGAAGCTCAACGATACGTGTGGGACGGTGCAATTCCGCTGCAAGTTCATCTTCACGACTCCGAAGTCACCACTCTACCGCCGCCTCCGCCTGCTCTGATC...

CDS

Download CDS FASTA

996 bp · TkA06G105850|TK1151|CDS

ATGCAAGGAGGAGAAAAAGAAGCTCAACGATACGTGTGGGACGGTGCAATTCCGCTGCAAGTTCATCTTCACGACTCCGAAGTCACCACTCTACCGCCGCCTCCGCCTGCTCTGATCCTAGCTCCACGAATAGGATACCTACCTCTGTTATCTTCACAACTCAAGCCGTTCTTTAGTGGTGCACTTCCTCCTGGAGTAGACACTGTCTGGTTTGAGTACAAAGGATTACCACTTAAATGGTATATACCAACAGGGGTCCT...

Protein

Download Protein FASTA

331 aa · TkA06G105850|TK1151|PROTEIN

MQGGEKEAQRYVWDGAIPLQVHLHDSEVTTLPPPPPALILAPRIGYLPLLSSQLKPFFSGALPPGVDTVWFEYKGLPLKWYIPTGVLFDLLCAEPERPWNLTVHFRGYPGNILIPCDGEDSVKWSYINSLKEAAYIIHGSSKNVMNMSQPDQVELWRSVINGKLETYNRISSKLKLGVMTDDFSEKINPSLKPQHTGNETEPTAPLKASRIPVRLYVWSVDQDFEDLEAVPHFESWDQISYINRPVEINKEGKYLTLQEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G105850`
TK1151 ID	TkA06G105850
OH-1004 ID	LXL04_024817
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 96.221 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G105850

Location Chr06:27994592-27997542 (+)

Description Similar to ATG5: Autophagy protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17290`	Required for autophagy.	Autophagic nutrient recycling in Arabidopsis directed by the ATG8 and ATG12 conjugation pathways.2005 · DOI: 10.1104/pp.105.060673 Stromal protein degradation is incomplete in Arabidopsis thaliana autophagy mutants undergoing natural senescence.2013 · DOI: 10.1186/1756-0500-6-17 Organ-specific quality control of plant peroxisomes is mediated by autophagy.2014 · DOI: 10.1242/jcs.139709

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X052`	Required for autophagy.	No verified direct reference in this release
`Os02g0117800`	Required for autophagy.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024817 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000423 mitophagy Biological Process

GO:0001974 blood vessel remodeling Biological Process

GO:0002376 immune system process Biological Process

GO:0002718 regulation of cytokine production involved in immune response Biological Process

GO:0006914 autophagy Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009620 response to fungus Biological Process

GO:0010040 response to iron(II) ion Biological Process

KEGG gene cross-reference

ath:AT5G17290

dosa:Os02g0117800

hsa:9474

mmu:11793

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA06G105850 · TK1151

Nucleus0.244

Rank 2 · TkA06G105850 · TK1151

Golgi apparatus0.177

Rank 3 · TkA06G105850 · TK1151

Lysosome / Vacuole0.121

Rank 4 · TkA06G105850 · TK1151

Endoplasmic reticulum0.115

Rank 5 · TkA06G105850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20638ATG5_UblA12-105 aa

PF04106ATG5_UblB17-30 aa

PF04106ATG5_UblB76-84 aa

PF20637ATG5_HBR119-175 aa

PF04106ATG5_UblB131-139 aa

PF04106ATG5_UblB210-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G105850	`PF20638`	ATG5_UblA	12	105	7.8e-29	100.9
TkA06G105850	`PF04106`	ATG5_UblB	17	30	6.6e-22	78.6
TkA06G105850	`PF04106`	ATG5_UblB	76	84	6.6e-22	78.6
TkA06G105850	`PF20637`	ATG5_HBR	119	175	7e-24	84.1
TkA06G105850	`PF04106`	ATG5_UblB	131	139	6.6e-22	78.6
TkA06G105850	`PF04106`	ATG5_UblB	210	318	6.6e-22	78.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFI2`	Arabidopsis thaliana	sp\|Q9FFI2\|ATG5_ARATH Autophagy protein 5	61.800%	Swiss-Prot	High
`A2X052`	Oryza sativa subsp. indica	sp\|A2X052\|ATG5_ORYSI Autophagy protein 5	54.600%	Swiss-Prot	High
`Q6ZGL4`	Oryza sativa subsp. japonica	sp\|Q6ZGL4\|ATG5_ORYSJ Autophagy protein 5	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card