RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G103100
Reference: TK1151 Chr: Chr06 Coordinates: 27361978-27367176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2525 bp · TkA06G103100|TK1151|cDNA

ATGACTACTGTTTTTTATATAAAAATTTGACAATTTTGAAGTAGCATCGTTCCATTGCTCCGACGGGATCTGAATTCTCTCCCTCTTATCACTGGATCGATATACTATTCTCTCATTTTCTAGATCCATCTACACCACCAGATCTCATTAACTTGCTCGTAGCGGCAGCCCCAAGAAGCCATGGAGAAAACATGCACTCTACTTGTCCACTTTGACAAAGGGACACCTGCACTTGCAAACGAGATCAAGGAGGCTCTTGA...

CDS

Download CDS FASTA

2847 bp · TkA06G103100|TK1151|CDS

ATGGAGAAAACATGCACTCTACTTGTCCACTTTGACAAAGGGACACCTGCACTTGCAAACGAGATCAAGGAGGCTCTTGAAGGCAACGATGATGCTGCAAAGATTGATGCCATGAAAAAAGCAGTCATGCTTTTACTAAATGGAGAAACACTACCACAGCTTTTCATCACAATTGTTCGATATGTTCTTCCTTCAGAGGACCACACTGTTCAAAAACTCCTCCTTCTTTACCTAGAAATCATCGACAAAACCGACTCAAA...

Protein

Download Protein FASTA

948 aa · TkA06G103100|TK1151|PROTEIN

MEKTCTLLVHFDKGTPALANEIKEALEGNDDAAKIDAMKKAVMLLLNGETLPQLFITIVRYVLPSEDHTVQKLLLLYLEIIDKTDSKGKILPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSILSNLEHRHPFIRRNAILAVMAIYKLPQGDQLLVDAPEMIEKVLSTEADQSAKRNAFLMLFTCAQERAVNYLLTHVERVAEWGELLQMVVLELIRKVCRANKGEKGKYIKIIISLLTVPSAAVIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G103100
TK1151 IDTkA06G103100
OH-1004 IDLXL04_024837
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)99.900
Protein coverage (%)TK1151 98.523 / OH-1004 78.819
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G103100
LocationChr06:27361978-27367176 (+)
DescriptionSimilar to At4g31480: Coatomer subunit beta-1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g31480 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
At4g31490 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0174000 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os01g0281400 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024837 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0030126 COPI vesicle coat Cellular Component
GO:0005198 structural molecule activity Molecular Function
KEGG gene cross-reference
ath:AT4G31480
ath:AT4G31490
dosa:Os01g0281400
dosa:Os11g0174000
dpo:4814235
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508
Rank 1 · TkA06G103100 · TK1151
Golgi apparatus0.414
Rank 2 · TkA06G103100 · TK1151
Nucleus0.167
Rank 3 · TkA06G103100 · TK1151
Lysosome / Vacuole0.146
Rank 4 · TkA06G103100 · TK1151
Endoplasmic reticulum0.108
Rank 5 · TkA06G103100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12717Cnd18-109 aa
PF01602Adaptin_N20-468 aa
PF22928INTS1_R471-151 aa
PF22956PIK3R4-like_middle94-143 aa
PF02985HEAT98-123 aa
PF13646HEAT_2101-170 aa
PF12717Cnd1112-238 aa
PF02985HEAT132-160 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G103100PF12717Cnd181095.1e-0524.1
TkA06G103100PF01602Adaptin_N204681.2e-90305.3
TkA06G103100PF22928INTS1_R4711510.0009219.8
TkA06G103100PF22956PIK3R4-like_middle941430.0004219.9
TkA06G103100PF02985HEAT981234.3e-0524.1
TkA06G103100PF13646HEAT_21011704.4e-0730.8
TkA06G103100PF12717Cnd11122385.1e-0524.1
TkA06G103100PF02985HEAT1321604.3e-0524.1
TkA06G103100PF13646HEAT_21762094.4e-0730.8
TkA06G103100PF13646HEAT_22422764.4e-0730.8
TkA06G103100PF02985HEAT2452714.3e-0524.1
TkA06G103100PF06535RGM_N2622890.1712.9
TkA06G103100PF13646HEAT_22843364.4e-0730.8
TkA06G103100PF12717Cnd12853415.1e-0524.1
TkA06G103100PF22928INTS1_R42883450.0009219.8
TkA06G103100PF22956PIK3R4-like_middle2993430.0004219.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SV21Arabidopsis thalianasp|Q9SV21|COPB1_ARATH Coatomer subunit beta-183.700%Swiss-ProtHigh
Q9SV20Arabidopsis thalianasp|Q9SV20|COPB2_ARATH Coatomer subunit beta-283.200%Swiss-ProtHigh
Q53PC7Oryza sativa subsp. japonicasp|Q53PC7|COPB1_ORYSJ Coatomer subunit beta-179.500%Swiss-ProtHigh
Q0JNK5Oryza sativa subsp. japonicasp|Q0JNK5|COPB2_ORYSJ Coatomer subunit beta-278.000%Swiss-ProtHigh

JBrowse

View in Genome Browser