TkA06G098130 | RubberDandelionOmics

Gene overview

TkA06G098130

Reference: TK1151 Chr: Chr06 Coordinates: 26203215-26212275 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA06G098130|TK1151|cDNA

ATGTTGATTGAAACCAGGCCATTGACGCCTATAGGTGCACCATCACCAACCCTGCTCGAGGAACTAAATGCTGGACAAGATGGTGAGTCAACTGGGTGCTGGGACTCGTTGTTTGAGCTTCAATCGTGCACTGGAGAAATCGTACTGTTCTTTCTAAATGGAGAAACTTATCTTGGAATGGGGTGTTGCAAGGCGATTGAGAAGATTGAAAAGAAATGCTGGCCCTCTTTGCTTGGATCATTTGGGTTTACTAATGAAGA...

CDS

Download CDS FASTA

408 bp · TkA06G098130|TK1151|CDS

ATGTTGATTGAAACCAGGCCATTGACGCCTATAGGTGCACCATCACCAACCCTGCTCGAGGAACTAAATGCTGGACAAGATGGTGAGTCAACTGGGTGCTGGGACTCGTTGTTTGAGCTTCAATCGTGCACTGGAGAAATCGTACTGTTCTTTCTAAATGGAGAAACTTATCTTGGAATGGGGTGTTGCAAGGCGATTGAGAAGATTGAAAAGAAATGCTGGCCCTCTTTGCTTGGATCATTTGGGTTTACTAATGAAGA...

Protein

Download Protein FASTA

135 aa · TkA06G098130|TK1151|PROTEIN

MLIETRPLTPIGAPSPTLLEELNAGQDGESTGCWDSLFELQSCTGEIVLFFLNGETYLGMGCCKAIEKIEKKCWPSLLGSFGFTNEEGDILRGYCDTSGDNGDLPTSAPPPVKAPPPVKANSTTSKSAVFNNGGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G098130`
TK1151 ID	TkA06G098130
OH-1004 ID	LXL04_024880
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 100.000 / OH-1004 87.755 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G098130

Location Chr06:26203215-26212275 (-)

Description Similar to EC1.1: Egg cell-secreted protein 1.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76750`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At2g21750`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At2g21740`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At4g39340`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024880 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0080155 regulation of double fertilization forming a zygote and endosperm Biological Process

GO:2000008 regulation of protein localization to cell surface Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:0031982 vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G76750

ath:AT2G21740

ath:AT2G21750

ath:AT4G39340

ath:AT5G64720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.490

Rank 1 · TkA06G098130 · TK1151

Endoplasmic reticulum0.199

Rank 2 · TkA06G098130 · TK1151

Cytoplasm0.144

Rank 3 · TkA06G098130 · TK1151

Lysosome / Vacuole0.111

Rank 4 · TkA06G098130 · TK1151

Cell membrane0.103

Rank 5 · TkA06G098130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05617Prolamin_like33-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G098130	`PF05617`	Prolamin_like	33	96	2.2e-18	66.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRD8`	Arabidopsis thaliana	sp\|Q9SRD8\|EC11_ARATH Egg cell-secreted protein 1.1	52.100%	Swiss-Prot	Medium
`Q9SJ23`	Arabidopsis thaliana	sp\|Q9SJ23\|EC13_ARATH Egg cell-secreted protein 1.3	57.100%	Swiss-Prot	Medium
`Q9SJ24`	Arabidopsis thaliana	sp\|Q9SJ24\|EC12_ARATH Egg cell-secreted protein 1.2	56.200%	Swiss-Prot	Medium
`Q9T039`	Arabidopsis thaliana	sp\|Q9T039\|EC14_ARATH Egg cell-secreted protein 1.4	53.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card