TkA06G097690 | RubberDandelionOmics

Gene overview

TkA06G097690

Reference: TK1151 Chr: Chr06 Coordinates: 26022539-26023710 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · TkA06G097690|TK1151|cDNA

ATGCATGAAACCATGAATATAGTGTATCTTTGCCTCTTCCAAAGGCAACTCAAATCACCCACATCCTATCAGGTTCTCATGTCTAACAACATAGCAGTAAAACAAGCTACAAAATATGAGACCCAAAGCTCCGGTGGTAATGGCCGAAAAACATCGTCGTTGCGGCCACCGGAGCAAGCCGTGAAGTGCCCAAGATGCGATTCAACAAATACCAAGTTTTGCTACTACAACAACTATAACCTTACGCAGCCCAGGCACTT...

CDS

Download CDS FASTA

1008 bp · TkA06G097690|TK1151|CDS

ATGCATGAAACCATGAATATAGTGTATCTTTGCCTCTTCCAAAGGCAACTCAAATCACCCACATCCTATCAGGTTCTCATGTCTAACAACATAGCAGTAAAACAAGCTACAAAATATGAGACCCAAAGCTCCGGTGGTAATGGCCGAAAAACATCGTCGTTGCGGCCACCGGAGCAAGCCGTGAAGTGCCCAAGATGCGATTCAACAAATACCAAGTTTTGCTACTACAACAACTATAACCTTACGCAGCCCAGGCACTT...

Protein

Download Protein FASTA

335 aa · TkA06G097690|TK1151|PROTEIN

MHETMNIVYLCLFQRQLKSPTSYQVLMSNNIAVKQATKYETQSSGGNGRKTSSLRPPEQAVKCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNIPIGGGCRKNKKTSKTSTSKFTIGNSSSGINFPPRINQLFPSSYPDTSCNLPFMNLDPLGVNNFGLSNNVTKPGDHQNQSGGGIGNCQELGFTYTNNLHQNTSTLASSIESLSSLNQDLHWKLQQQRLAMLFGGGAEEEDGHQQKESSLQPILFQNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G097690`
TK1151 ID	TkA06G097690
OH-1004 ID	LXL04_024892
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.600
Protein coverage (%)	TK1151 92.239 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G097690

Location Chr06:26022539-26023710 (-)

Description Similar to DOF5.7: Dof zinc finger protein DOF5.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65590`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At2g28810`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At3g55370`	Transcription factor that binds specifically to a 5'-AA[AG]G- 3' consensus core sequence.	Target genes for OBP3, a Dof transcription factor, include novel basic helix-loop-helix domain proteins inducible by salicylic acid.2003 · DOI: 10.1046/j.1365-313x.2003.01812.x
`At4g38000`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	Overexpression of AtDOF4.7, an Arabidopsis DOF family transcription factor, induces floral organ abscission deficiency in Arabidopsis.2010 · DOI: 10.1104/pp.110.153247

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024892 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:1902066 regulation of cell wall pectin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0055044 symplast Cellular Component

KEGG gene cross-reference

ath:AT2G28810

ath:AT2G37590

ath:AT3G45610

ath:AT5G60200

ath:AT5G65590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA06G097690 · TK1151

Cytoplasm0.110

Rank 2 · TkA06G097690 · TK1151

Cell membrane0.024

Rank 3 · TkA06G097690 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA06G097690 · TK1151

Plastid0.011

Rank 5 · TkA06G097690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27511ComFA_N15-91 aa

PF23451Zn_ribbon_PaaD51-92 aa

PF14369Zn_ribbon_1953-68 aa

PF02701Zn_ribbon_Dof59-115 aa

PF10122Zn_ribbon_Com60-70 aa

PF27208TP_021462-93 aa

PF14369Zn_ribbon_1985-96 aa

PF10122Zn_ribbon_Com88-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G097690	`PF27511`	ComFA_N	15	91	0.33	12.1
TkA06G097690	`PF23451`	Zn_ribbon_PaaD	51	92	0.0018	18.6
TkA06G097690	`PF14369`	Zn_ribbon_19	53	68	6.8	7.6
TkA06G097690	`PF02701`	Zn_ribbon_Dof	59	115	1.3e-33	115.7
TkA06G097690	`PF10122`	Zn_ribbon_Com	60	70	0.1	12.8
TkA06G097690	`PF27208`	TP_0214	62	93	0.041	14.3
TkA06G097690	`PF14369`	Zn_ribbon_19	85	96	6.8	7.6
TkA06G097690	`PF10122`	Zn_ribbon_Com	88	106	0.1	12.8
TkA06G097690	`PF02701`	Zn_ribbon_Dof	192	202	1.3e-33	115.7
TkA06G097690	`PF23451`	Zn_ribbon_PaaD	196	210	0.0018	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSL6`	Arabidopsis thaliana	sp\|Q9LSL6\|DOF57_ARATH Dof zinc finger protein DOF5.7	41.600%	Swiss-Prot	Medium
`Q9ZV33`	Arabidopsis thaliana	sp\|Q9ZV33\|DOF22_ARATH Dof zinc finger protein DOF2.2	83.600%	Swiss-Prot	Low
`Q84TE9`	Arabidopsis thaliana	sp\|Q84TE9\|DOF53_ARATH Dof zinc finger protein DOF5.3	78.500%	Swiss-Prot	Low
`Q9M2U1`	Arabidopsis thaliana	sp\|Q9M2U1\|DOF36_ARATH Dof zinc finger protein DOF3.6	31.500%	Swiss-Prot	Medium
`Q84K52`	Arabidopsis thaliana	sp\|Q84K52\|DOF47_ARATH Dof zinc finger protein DOF4.7	36.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card