TkA06G096530 | RubberDandelionOmics

Gene overview

TkA06G096530

Reference: TK1151 Chr: Chr06 Coordinates: 25693168-25696774 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · TkA06G096530|TK1151|cDNA

ATGATGGCTAGGGAAAAAATAGAGATTAAAAAGATTGATAATGCTACAGCGAGACAGGTGACCTTCTCCAAAAGGAGGAGAGGGCTGTTCAAGAAAGCTGAAGAGCTCTCTGTACTTTGTGATGCTGACGTGGCTCTCGTCATCTTCTCCGCTACTGGTAAACTGTTTCAGTATTCTAGCTCTAGCATGAAAGGAATACTTGAAAGGCATAGCCTGCATTCCAAAAATCTCCAGAAGCTTGACCAACCATCACTTGAATT...

CDS

Download CDS FASTA

693 bp · TkA06G096530|TK1151|CDS

ATGATGGCTAGGGAAAAAATAGAGATTAAAAAGATTGATAATGCTACAGCGAGACAGGTGACCTTCTCCAAAAGGAGGAGAGGGCTGTTCAAGAAAGCTGAAGAGCTCTCTGTACTTTGTGATGCTGACGTGGCTCTCGTCATCTTCTCCGCTACTGGTAAACTGTTTCAGTATTCTAGCTCTAGCATGAAAGGAATACTTGAAAGGCATAGCCTGCATTCCAAAAATCTCCAGAAGCTTGACCAACCATCACTTGAATT...

Protein

Download Protein FASTA

230 aa · TkA06G096530|TK1151|PROTEIN

MMAREKIEIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALVIFSATGKLFQYSSSSMKGILERHSLHSKNLQKLDQPSLELQLVEDANYAKLSKEVAERTLQLRRLRGEELHHLTIEELHQLEKSLEAGLGLVVAKKGEVIMHEINCLQEKGTQLMEENVRLRQEMVKISKTQKQIHGDTENVIGEEGQSSESLTNISDSADPVQQDYESSYTSLKLWLVHSLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G096530`
TK1151 ID	TkA06G096530
OH-1004 ID	LXL04_024457
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.300
Protein coverage (%)	TK1151 79.130 / OH-1004 80.088 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G096530

Location Chr06:25693168-25696774 (+)

Description Similar to MADS27: MADS-box transcription factor 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22540`	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature.	No verified direct reference in this release
`At4g24540`	Transcription activator that mediates floral transition in response to vernalization.	AGAMOUS-LIKE 24, a dosage-dependent mediator of the flowering signals.2002 · DOI: 10.1073/pnas.212624599 AGL24 acts as a promoter of flowering in Arabidopsis and is positively regulated by vernalization.2003 · DOI: 10.1046/j.1365-313x.2003.01671.x An Arabidopsis MADS-box protein, AGL24, is specifically bound to and phosphorylated by meristematic receptor-like kinase (MRLK).2003 · DOI: 10.1093/pcp/pcg092 AGL24, SHORT VEGETATIVE PHASE, and APETALA1 redundantly control AGAMOUS during early stages of flower development in Arabidopsis.2006 · DOI: 10.1105/tpc.106.041798 Direct interaction of AGL24 and SOC1 integrates flowering signals in Arabidopsis.2008 · DOI: 10.1242/dev.020255 AGAMOUS-LIKE24 and SHORT VEGETATIVE PHASE determine floral meristem identity in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03648.x The Arabidopsis floral meristem identity genes AP1, AGL24 and SVP directly repress class B and C floral homeotic genes.2009 · DOI: 10.1111/j.1365-313x.2009.03985.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186600`	Transcription factor that modulates expressions of multiple genes involved in cell signaling and gene transcription.	A brassinolide-suppressed rice MADS-box transcription factor, OsMDP1, has a negative regulatory role in BR signaling.2006 · DOI: 10.1111/j.1365-313x.2006.02804.x
`Os02g0761000`	Probable transcription factor.	OsMADS22, an STMADS11-like MADS-box gene of rice, is expressed in non-vegetative tissues and its ectopic expression induces spikelet meristem indeterminacy.2005 · DOI: 10.1007/s00438-004-1093-6 Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses.2008 · DOI: 10.1111/j.1365-313x.2008.03406.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G22630

ath:AT3G57230

ath:AT4G37940

dosa:Os02g0579600

dosa:Os02g0731200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA06G096530 · TK1151

Cytoplasm0.121

Rank 2 · TkA06G096530 · TK1151

Cell membrane0.027

Rank 3 · TkA06G096530 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA06G096530 · TK1151

Plastid0.012

Rank 5 · TkA06G096530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF11-58 aa

PF00170bZIP_123-36 aa

PF01486K-box70-82 aa

PF29645CHCH3_N91-121 aa

PF01486K-box93-172 aa

PF06156YabA100-122 aa

PF24670DUF7653107-183 aa

PF00170bZIP_1123-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G096530	`PF00319`	SRF-TF	11	58	7e-26	90.1
TkA06G096530	`PF00170`	bZIP_1	23	36	0.21	12.4
TkA06G096530	`PF01486`	K-box	70	82	8.9e-16	58.5
TkA06G096530	`PF29645`	CHCH3_N	91	121	0.073	13.9
TkA06G096530	`PF01486`	K-box	93	172	8.9e-16	58.5
TkA06G096530	`PF06156`	YabA	100	122	0.77	11.1
TkA06G096530	`PF24670`	DUF7653	107	183	0.0036	18.1
TkA06G096530	`PF00170`	bZIP_1	123	131	0.21	12.4
TkA06G096530	`PF27490`	Rem	132	163	0.11	13.5
TkA06G096530	`PF06156`	YabA	145	203	0.77	11.1
TkA06G096530	`PF00170`	bZIP_1	150	181	0.21	12.4
TkA06G096530	`PF29645`	CHCH3_N	163	181	0.073	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVC1`	Arabidopsis thaliana	sp\|Q9FVC1\|SVP_ARATH MADS-box protein SVP	58.400%	Swiss-Prot	High
`O82794`	Arabidopsis thaliana	sp\|O82794\|AGL24_ARATH MADS-box protein AGL24	54.600%	Swiss-Prot	High
`Q5K4R0`	Oryza sativa subsp. japonica	sp\|Q5K4R0\|MAD47_ORYSJ MADS-box transcription factor 47	53.600%	Swiss-Prot	High
`Q9XJ66`	Oryza sativa subsp. japonica	sp\|Q9XJ66\|MAD22_ORYSJ MADS-box transcription factor 22	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card