TkA06G094810 | RubberDandelionOmics

Gene overview

TkA06G094810

Reference: TK1151 Chr: Chr06 Coordinates: 25210038-25212873 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

835 bp · TkA06G094810|TK1151|cDNA

GCATTTATGTTTGTGTAAAATTGTAGGTCATGCTACATATATATGTACCCACAATTTCAGCAGTTCCTACTTACTCCCAAACTCCTATTTGGGACTTTGGGTCATCTTGTTACCAAATGGCTTTCTGTAATCCCCCCACCCTTTTACCTTCATTGTCTTCCCCACCTCAACTCCATTCCAACTCCAACCGTATCCTCCTCCGACGAATGCCGCGAAGAGTTCTCACCGTAAAAATGGCGAAAAATTCAACCACACAGAAT...

CDS

Download CDS FASTA

1434 bp · TkA06G094810|TK1151|CDS

ATGCTACATATATATGTACCCACAATTTCAGCAGTTCCTACTTACTCCCAAACTCCTATTTGGGACTTTGGGTCATCTTGTTACCAAATGGCTTTCTGTAATCCCCCCACCCTTTTACCTTCATTGTCTTCCCCACCTCAACTCCATTCCAACTCCAACCGTATCCTCCTCCGACGAATGCCGCGAAGAGTTCTCACCGTAAAAATGGCGAAAAATTCAACCACACAGAATGATGATGGCGATACCCGCCCAAAACCCAC...

Protein

Download Protein FASTA

477 aa · TkA06G094810|TK1151|PROTEIN

MLHIYVPTISAVPTYSQTPIWDFGSSCYQMAFCNPPTLLPSLSSPPQLHSNSNRILLRRMPRRVLTVKMAKNSTTQNDDGDTRPKPTKFVTFLGKGGSGKTFSAVFAAQHYAMKGLKTCLVLHSQDPTADYILNQKIGTTPVTCNDNLSAVRLETTKMILEPLNQLKQADARLNLTQGVLEGVVGEEFGVLPGMDTIFSALALENLIGFLRNKTQKNNYDVVIYDGLSTEETIRLIGATGKSRLYIKYLRNLAEKTDLGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G094810`
TK1151 ID	TkA06G094810
OH-1004 ID	LXL04_024941
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 97.275 / OH-1004 92.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G094810

Location Chr06:25210038-25212873 (+)

Description Similar to At1g26090: Uncharacterized protein At1g26090, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26090`	ATPase binding tail-anchored (TA) integral membrane protein and required for the homeostasis of photosynthetic machinery.	Structures of Get3d reveal a distinct architecture associated with the emergence of photosynthesis.2023 · DOI: 10.1016/j.jbc.2023.104752

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071806 protein transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015446 ATPase-coupled arsenite transmembrane transporter activity Molecular Function

GO:0015450 protein-transporting ATPase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G26090

cte:CT1945

syn:sll0086

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA06G094810 · TK1151

Mitochondrion0.042

Rank 2 · TkA06G094810 · TK1151

Nucleus0.021

Rank 3 · TkA06G094810 · TK1151

Cytoplasm0.021

Rank 4 · TkA06G094810 · TK1151

Peroxisome0.014

Rank 5 · TkA06G094810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02374ArsA_ATPase87-318 aa

PF20720nSTAND387-131 aa

PF02562PhoH88-148 aa

PF13481AAA_2588-117 aa

PF01656CbiA94-235 aa

PF02562PhoH172-215 aa

PF13481AAA_25223-258 aa

PF17886ArsA_HSP20418-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G094810	`PF02374`	ArsA_ATPase	87	318	8.1e-19	68.7
TkA06G094810	`PF20720`	nSTAND3	87	131	0.29	11.5
TkA06G094810	`PF02562`	PhoH	88	148	0.18	12.0
TkA06G094810	`PF13481`	AAA_25	88	117	0.27	11.5
TkA06G094810	`PF01656`	CbiA	94	235	0.0039	17.8
TkA06G094810	`PF02562`	PhoH	172	215	0.18	12.0
TkA06G094810	`PF13481`	AAA_25	223	258	0.27	11.5
TkA06G094810	`PF17886`	ArsA_HSP20	418	476	8e-13	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DYE4`	Arabidopsis thaliana	sp\|Q6DYE4\|GET3D_ARATH ATPase GET3D, chloroplastic	61.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card