RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G094270
Reference: TK1151 Chr: Chr06 Coordinates: 25050259-25054353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2384 bp · TkA06G094270|TK1151|cDNA

CTAATCCTGGTTGCGGTGGTATTTTCAAAACAAGTTTAATATTTTATTACCTTCTCACCACATCTTATTTAGTTTCATGATATTTTCGAAGTACTCTATAGAGTGGTTGCTCTGTTACGGACTTACGGTGATTAAAAAACGTCTTCTATACATTTGGTGACGGGAATAGCAAAAGAGCGATAGTTGAGGGGCTTTTTCAGAAGTAATGTTCCCTGAAAAGTGCAATTTCTCCCAATTTTCTCTCGATACTGCAGCTACGC...

CDS

Download CDS FASTA

1764 bp · TkA06G094270|TK1151|CDS

ATGTCAATGGGAGACGAACCTTTGTACCCAATAGCAGTACTAATCGATGAACTGAAGAATGACGACATCCAATTGCGGTTAAATTCTATCAGAAGACTTTCAACAATCGCACGTGCACTAGGGGAAGAACGCACTCGAAAGGAGTTAATCCCTTTCTTGAGTGAAAACAATGACGATGATGATGAAGTTCTTCTTGCCATGGCAGAAGAGTTAGGTGTGTTCATTCCTTATGTTGGAGGAGTTGACCATGCCAATGTTCT...

Protein

Download Protein FASTA

587 aa · TkA06G094270|TK1151|PROTEIN

MSMGDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVREKAVESLCRIGSQMKDTNLVEFFVPLVKRLAAGEWFTARVSACGLFHIAYPSAPDALKAELRSVYSQLCQDDMPMVRRSAATNLGKFAATMEPAHLKTEIMQIFEDLTQDDQDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G094270
TK1151 IDTkA06G094270
OH-1004 IDLXL04_024954
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 33.049 / OH-1004 33.049
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G094270
LocationChr06:25050259-25054353 (+)
DescriptionSimilar to PP2AA2: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g25800 The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
Disparate roles for the regulatory A subunit isoforms in Arabidopsis protein phosphatase 2A.2004 · DOI: 10.1105/tpc.018994
At1g25490 The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
The RCN1-encoded A subunit of protein phosphatase 2A increases phosphatase activity in vivo.1999 · DOI: 10.1046/j.1365-313x.1999.00607.x
The Arabidopsis eer1 mutant has enhanced ethylene responses in the hypocotyl and stem.2001 · DOI: 10.1104/pp.125.2.1061
Genetic and chemical reductions in protein phosphatase activity alter auxin transport, gravity response, and lateral root growth.2001 · DOI: 10.1105/tpc.010158
Disruption of a guard cell-expressed protein phosphatase 2A regulatory subunit, RCN1, confers abscisic acid insensitivity in Arabidopsis.2002 · DOI: 10.1105/tpc.003335
Enhanced ethylene responsiveness in the Arabidopsis eer1 mutant results from a loss-of-function mutation in the protein phosphatase 2A A regulatory subunit, RCN1.2003 · DOI: 10.1046/j.1365-313x.2003.01762.x
Disparate roles for the regulatory A subunit isoforms in Arabidopsis protein phosphatase 2A.2004 · DOI: 10.1105/tpc.018994
A mutation in protein phosphatase 2A regulatory subunit A affects auxin transport in Arabidopsis.1996 · PMID: 8641277
At1g13320 The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
Disparate roles for the regulatory A subunit isoforms in Arabidopsis protein phosphatase 2A.2004 · DOI: 10.1105/tpc.018994

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024954 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0042325 regulation of phosphorylation Biological Process
GO:0000159 protein phosphatase type 2A complex Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G13320
ath:AT1G25490
ath:AT3G25800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.708
Rank 1 · TkA06G094270 · TK1151
Nucleus0.304
Rank 2 · TkA06G094270 · TK1151
Golgi apparatus0.165
Rank 3 · TkA06G094270 · TK1151
Cell membrane0.131
Rank 4 · TkA06G094270 · TK1151
Lysosome / Vacuole0.124
Rank 5 · TkA06G094270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13646HEAT_211-110 aa
PF20168PDS512-72 aa
PF10363RTP1_C112-76 aa
PF23271HEAT_GCN112-111 aa
PF00514Arm12-30 aa
PF25786HEAT_GCN1_C13-52 aa
PF23227HEAT_MROH2B_C13-71 aa
PF02985HEAT18-38 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G094270PF13646HEAT_2111108.4e-30103.6
TkA06G094270PF20168PDS512721.9e-1143.3
TkA06G094270PF10363RTP1_C112764.1e-0937.2
TkA06G094270PF23271HEAT_GCN1121114.3e-0627.7
TkA06G094270PF00514Arm12300.113.4
TkA06G094270PF25786HEAT_GCN1_C13528.8e-1039.5
TkA06G094270PF23227HEAT_MROH2B_C13711.1e-0628.9
TkA06G094270PF02985HEAT18382.4e-54176.8
TkA06G094270PF22646PPP2R1A-like_HEAT18671.4e-46157.5
TkA06G094270PF01602Adaptin_N182206.7e-0729.0
TkA06G094270PF30357RELCH_N191217.2e-2175.8
TkA06G094270PF25567TPR_SYO119500.02315.0
TkA06G094270PF29896PPFR1_M22814e-52175.8
TkA06G094270PF22956PIK3R4-like_middle241134.9e-2692.0
TkA06G094270PF26715HEAT_GCN1_233950.0004421.0
TkA06G094270PF13513HEAT_EZ47542.5e-1041.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q38950Arabidopsis thalianasp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform89.200%Swiss-ProtLow
Q38845Arabidopsis thalianasp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform84.000%Swiss-ProtLow
Q38951Arabidopsis thalianasp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform84.500%Swiss-ProtLow

JBrowse

View in Genome Browser