TkA06G090420 | RubberDandelionOmics

Gene overview

TkA06G090420

Reference: TK1151 Chr: Chr06 Coordinates: 24071112-24074471 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1784 bp · TkA06G090420|TK1151|cDNA

CTACCACTCGCCATAACTCTCTTTTGGTGCAAATAGAATCCCCAAAGGCTTCACCCTCTGTCGTTTCCAGTTCCCCAATCAATCAATGGCGACATACAAGCTCGCAGCGATCATCAGAAACTCTACCAATAACGACGAATTCCTTCTCGTTAAGCAAACTCCGCCCCCCAAATACGATGACCAAGAATACGACTCGTTTGCTGACTCCACACTCTGGGACTTGCCGTCAGCGAAATTGACCTCGCTATCACCGGAATCAG...

CDS

Download CDS FASTA

1563 bp · TkA06G090420|TK1151|CDS

ATGGCGACATACAAGCTCGCAGCGATCATCAGAAACTCTACCAATAACGACGAATTCCTTCTCGTTAAGCAAACTCCGCCCCCCAAATACGATGACCAAGAATACGACTCGTTTGCTGACTCCACACTCTGGGACTTGCCGTCAGCGAAATTGACCTCGCTATCACCGGAATCAGATTCATCTACTCAACTCGTACTGCAAGGTGAAGAATCGTGTTTGCATAAGCTCAATTTCAGGAAATTTGATCTTCTTTCAGCTCT...

Protein

Download Protein FASTA

520 aa · TkA06G090420|TK1151|PROTEIN

MATYKLAAIIRNSTNNDEFLLVKQTPPPKYDDQEYDSFADSTLWDLPSAKLTSLSPESDSSTQLVLQGEESCLHKLNFRKFDLLSALAEVLGQVGLESVTGVDWKFLKYVEEPNFGPGFPIQTVYVTADLVLNNLKDTCQWSSIEICSNMLVQVKPGNDRVGPLVVNGQLNNSIQSDSLKLPPTLSCQEYPPGVNIVPMGSKTQRPFHTTNIIVFSSRNNHDKYETSHFVAQGDAMIVDPGCRSEFNKELAEIVAALPRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G090420`
TK1151 ID	TkA06G090420
OH-1004 ID	LXL04_024987
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.577 / OH-1004 95.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G090420`
Location	Chr06:24071112-24074471 (-)
Description	Similar to lactb2: Endoribonuclease LACTB2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024987` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0031123 RNA 3'-end processing Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0003727 single-stranded RNA binding Molecular Function GO:0004521 RNA endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	bta:535021 dme:Dmel_CG12375 rno:297768 xla:495268 xtr:779879 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.446

Rank 1 · TkA06G090420 · TK1151

Cytoplasm0.239

Rank 2 · TkA06G090420 · TK1151

Plastid0.129

Rank 3 · TkA06G090420 · TK1151

Nucleus0.127

Rank 4 · TkA06G090420 · TK1151

Peroxisome0.095

Rank 5 · TkA06G090420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23023Anti-Pycsar_Apyc1227-280 aa

PF00753Lactamase_B230-351 aa

PF19583ODP231-352 aa

PF12706Lactamase_B_2253-301 aa

PF17778WHD_BLACT425-461 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G090420	`PF23023`	Anti-Pycsar_Apyc1	227	280	0.0031	18.0
TkA06G090420	`PF00753`	Lactamase_B	230	351	5.3e-08	33.7
TkA06G090420	`PF19583`	ODP	231	352	0.0057	17.3
TkA06G090420	`PF12706`	Lactamase_B_2	253	301	0.0012	19.2
TkA06G090420	`PF17778`	WHD_BLACT	425	461	6.1e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card