TkA06G089810 | RubberDandelionOmics

Gene overview

TkA06G089810

Reference: TK1151 Chr: Chr06 Coordinates: 23872031-23872959 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

589 bp · TkA06G089810|TK1151|cDNA

TCGTGAGTTGAGGTTTGGATTCAGGCTGGAAATTGATAGGTATACGATTGTATTATAATTCTCCTGTTTTTTTGTTTTGTAGTTGAATCTTTAGTTGAAAGCTGTATACCTCAAACTGAATCGGTTCCAACAAGGTTTGTCTTTATTCTGCACATAAACTCAAATTCAACTCCATCAGATTATAATAAAGTTTCAGTAAAAAGTAATTAGTAATTACACTTTTCTGGTGATTTCAAAAGTTATGACAAAGAATCCAATCT...

CDS

Download CDS FASTA

348 bp · TkA06G089810|TK1151|CDS

ATGACAAAGAATCCAATCTATGTCCTATCTGATACTCTTGCAGTGGAAGCCCTGCAAAAGATGGTGCAAGGAAAGTTTAGACACTTGCCAGTTGTAGAGAATGGGGAGGTTATTGCTTTAATAGATATAGCAAAATGTTTATATGATGCTATTGCCCGTATGGAAAGGGCTGCTGAAAAGGGGAAGGCTATAGCAGCTGCTGTTGAAGGTGTTGAGAAGCATTGGGGAAGTACTTTACCTGGTCCCAACTCATTCATTGA...

Protein

Download Protein FASTA

115 aa · TkA06G089810|TK1151|PROTEIN

MTKNPIYVLSDTLAVEALQKMVQGKFRHLPVVENGEVIALIDIAKCLYDAIARMERAAEKGKAIAAAVEGVEKHWGSTLPGPNSFIETLRERMFKPALSTIISENTLSTKNIFLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G089810`
TK1151 ID	TkA06G089810
OH-1004 ID	LXL04_007857
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.700
Protein coverage (%)	TK1151 100.000 / OH-1004 54.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G089810

Location Chr06:23872031-23872959 (-)

Description Similar to CBSCBSPB5: CBS domain-containing protein CBSCBSPB5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50530`	CBS domain-containing protein CBSCBSPB4.	No verified direct reference in this release
`At5g50640`	CBS domain-containing protein CBSCBSPB5.	No verified direct reference in this release
`At5g63490`	CBS domain-containing protein CBSCBSPB1.	No verified direct reference in this release
`At3g52950`	CBS domain-containing protein CBSCBSPB3.	No verified direct reference in this release
`At2g36500`	CBS domain-containing protein CBSCBSPB2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36500

ath:AT3G52950

ath:AT5G50530

ath:AT5G50640

ath:AT5G63490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA06G089810 · TK1151

Cell membrane0.308

Rank 2 · TkA06G089810 · TK1151

Nucleus0.248

Rank 3 · TkA06G089810 · TK1151

Lysosome / Vacuole0.137

Rank 4 · TkA06G089810 · TK1151

Golgi apparatus0.119

Rank 5 · TkA06G089810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00571CBS1-42 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G089810	`PF00571`	CBS	1	42	6e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WLC7`	Arabidopsis thaliana	sp\|Q0WLC7\|Y5053_ARATH CBS domain-containing protein CBSCBSPB4	84.900%	Swiss-Prot	High
`P0DH79`	Arabidopsis thaliana	sp\|P0DH79\|Y5064_ARATH CBS domain-containing protein CBSCBSPB5	84.900%	Swiss-Prot	High
`Q9FMV3`	Arabidopsis thaliana	sp\|Q9FMV3\|Y5349_ARATH CBS domain-containing protein CBSCBSPB1	84.000%	Swiss-Prot	High
`Q9LF97`	Arabidopsis thaliana	sp\|Q9LF97\|Y3295_ARATH CBS domain-containing protein CBSCBSPB3	79.200%	Swiss-Prot	High
`Q9SJQ5`	Arabidopsis thaliana	sp\|Q9SJQ5\|Y2650_ARATH CBS domain-containing protein CBSCBSPB2	76.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card