TkA06G087920 | RubberDandelionOmics

Gene overview

TkA06G087920

Reference: TK1151 Chr: Chr06 Coordinates: 23440718-23441840 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

821 bp · TkA06G087920|TK1151|cDNA

TCAGACTCATCCTCAAGCTACCTTCTCAACCACGTTGATCTGCCTTCACTCTACTATCAAACCAGCAATGAAAATGGTGGTATTATTGACTTGGGGCTTAGTCTTAGAGTTTTGCAGCCAGAAAATCCCCATGATGACTATCACAATCTGGTAGAATGGAATCAGTTACACCCTTTTGAAAGTCCAAATGTTGGTGTCACCGAAAGAAACGCATTCCAAAGAGGAGTGCAACAAAGCGATTTTGTGAAGGTTAACATGGA...

CDS

Download CDS FASTA

537 bp · TkA06G087920|TK1151|CDS

TCAGACTCATCCTCAAGCTACCTTCTCAACCACGTTGATCTGCCTTCACTCTACTATCAAACCAGCAATGAAAATGGTGGTATTATTGACTTGGGGCTTAGTCTTAGAGTTTTGCAGCCAGAAAATCCCCATGATGACTATCACAATCTGGTAGAATGGAATCAGTTACACCCTTTTGAAAGTCCAAATGTTGGTGTCACCGAAAGAAACGCATTCCAAAGAGGAGTGCAACAAAGCGATTTTGTGAAGGTTAACATGGA...

Protein

Download Protein FASTA

178 aa · TkA06G087920|TK1151|PROTEIN

SDSSSSYLLNHVDLPSLYYQTSNENGGIIDLGLSLRVLQPENPHDDYHNLVEWNQLHPFESPNVGVTERNAFQRGVQQSDFVKVNMDGVLVGRKISVIDHSSYSSLATQLEDMFGKQCLSGLRLFEGGSEFSLWYKDRDEQWRVVGDVPWKEFVDTVKRIRIMLMKDETLIQFTSTLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G087920`
TK1151 ID	TkA06G087920
OH-1004 ID	LXL04_025010
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 98.876 / OH-1004 97.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G087920

Location Chr06:23440718-23441840 (+)

Description Similar to IAA32: Auxin-responsive protein IAA32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01200`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At1g15050`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At2g33310`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At1g04550`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XB18`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G04550

ath:AT1G15050

ath:AT2G01200

ath:AT2G33310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.719

Rank 1 · TkA06G087920 · TK1151

Cytoplasm0.328

Rank 2 · TkA06G087920 · TK1151

Cell membrane0.089

Rank 3 · TkA06G087920 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA06G087920 · TK1151

Lysosome / Vacuole0.025

Rank 5 · TkA06G087920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309AUX_IAA73-168 aa

PF22185AF_0924127-160 aa

PF20909SpGH101_helical146-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G087920	`PF02309`	AUX_IAA	73	168	2.3e-24	87.1
TkA06G087920	`PF22185`	AF_0924	127	160	0.12	13.1
TkA06G087920	`PF20909`	SpGH101_helical	146	168	0.35	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RYC6`	Arabidopsis thaliana	sp\|Q8RYC6\|IAA32_ARATH Auxin-responsive protein IAA32	44.800%	Swiss-Prot	Medium
`Q9C5X0`	Arabidopsis thaliana	sp\|Q9C5X0\|IAA34_ARATH Auxin-responsive protein IAA34	46.800%	Swiss-Prot	Medium
`Q38831`	Arabidopsis thaliana	sp\|Q38831\|IAA13_ARATH Auxin-responsive protein IAA13	48.500%	Swiss-Prot	Medium
`Q38830`	Arabidopsis thaliana	sp\|Q38830\|IAA12_ARATH Auxin-responsive protein IAA12	51.600%	Swiss-Prot	Low
`A2XB18`	Oryza sativa subsp. indica	sp\|A2XB18\|IAA10_ORYSI Auxin-responsive protein IAA10	46.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card