TkA06G086450 | RubberDandelionOmics

Gene overview

TkA06G086450

Reference: TK1151 Chr: Chr06 Coordinates: 23122110-23122949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · TkA06G086450|TK1151|cDNA

ATGGATAATTATAATTTCATAAGTCAAGATACCTGGTGGAGAAGCGAAACTTCAAAACAAAATCCTCAGACCAATTACTCATATGAAGAGGAGTTTTATAATAACGAGTGTTACGATGATGATCTATACGAAAATCATGAATCCATTCATTATCGTAATAATTCATATGAAGATGAGTTTTACGATAATGTGTGTGATTATGGTGATCCGTATGAGTCATACGATAATGATTGGCAGTGGACCGCCAATTCAGTTCAAAA...

CDS

Download CDS FASTA

810 bp · TkA06G086450|TK1151|CDS

ATGGATAATTATAATTTCATAAGTCAAGATACCTGGTGGAGAAGCGAAACTTCAAAACAAAATCCTCAGACCAATTACTCATATGAAGAGGAGTTTTATAATAACGAGTGTTACGATGATGATCTATACGAAAATCATGAATCCATTCATTATCGTAATAATTCATATGAAGATGAGTTTTACGATAATGTGTGTGATTATGGTGATCCGTATGAGTCATACGATAATGATTGGCAGTGGACCGCCAATTCAGTTCAAAA...

Protein

Download Protein FASTA

269 aa · TkA06G086450|TK1151|PROTEIN

MDNYNFISQDTWWRSETSKQNPQTNYSYEEEFYNNECYDDDLYENHESIHYRNNSYEDEFYDNVCDYGDPYESYDNDWQWTANSVQNQYQDSSSFSENQESSDEYSSDDKLDQMLDMIMKSCDMQEKSLSNIQRSIEYISEQLNQQSSDNISDTMHENEVSFLSSDELYDTKMHKPTPPELEVVVEDYVSLNDKKTEKRQNNQINLYEPIIPKVGEGLVEVNTTSSPTTLSNPDAQPFLVTDFKSLFMYKKINDLSPSEC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G086450`
TK1151 ID	TkA06G086450
OH-1004 ID	LXL04_032396
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.900
Protein coverage (%)	TK1151 89.963 / OH-1004 25.426 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G086450`
Location	Chr06:23122110-23122949 (+)
Description	Similar to DEGP2: Protease Do-like 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032396` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0009658 chloroplast organization Biological Process GO:0010206 photosystem II repair Biological Process GO:0030163 protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009533 chloroplast stromal thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009570 chloroplast stroma Cellular Component
KEGG gene cross-reference	ath:AT1G65630 ath:AT2G47940 ath:AT5G40200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA06G086450 · TK1151

Nucleus0.483

Rank 2 · TkA06G086450 · TK1151

Mitochondrion0.062

Rank 3 · TkA06G086450 · TK1151

Cell membrane0.056

Rank 4 · TkA06G086450 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA06G086450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09849DUF207664-109 aa

PF09177STX6_10_61_N69-149 aa

PF23067MG28082-154 aa

PF07851TMEM120A-B93-162 aa

PF09849DUF2076124-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G086450	`PF09849`	DUF2076	64	109	0.72	10.6
TkA06G086450	`PF09177`	STX6_10_61_N	69	149	0.28	12.4
TkA06G086450	`PF23067`	MG280	82	154	9.8	6.3
TkA06G086450	`PF07851`	TMEM120A-B	93	162	4.2	7.3
TkA06G086450	`PF09849`	DUF2076	124	182	0.72	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card