TkA06G086180 | RubberDandelionOmics

Gene overview

TkA06G086180

Reference: TK1151 Chr: Chr06 Coordinates: 23061512-23063078 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1178 bp · TkA06G086180|TK1151|cDNA

CTGTCACCAAAACTCCCCAAATGTACGCGGGAATCAGGATGTGGAGTTTTTGTCCCGCCAAATTTCTAAATCCTTTTATAGTTACTTACTCTTCACTTCCTTTTCCGTGAATCCGTTTCATTTTCTGTGAGTCGCAACCAGTGACTAATCCTGATTCGTTATTTATTTCGCCTTAGGGTTTTGTATTCTTTTGTAAAGGTAGGTCAGAAATCAGGGTTTTATCGTTCATCTCGAAGAGATAGATAATCATGAGCGCTGTG...

CDS

Download CDS FASTA

666 bp · TkA06G086180|TK1151|CDS

ATGAGCGCTGTGAATCTAACAAATGTTAGCGTATTAAACAATCCATCGCCCTTCCTTAGTCCTTTCCAGTTCGAAATCTCGTATGAGTGCCTGCTTCCTCTCAAAGACGATTTGGAATGGAAACTAACTTATGTGGGATCTGCTGAAGACGAGACCTATGATCAACTCCTCGAAAGCGTCCTTGTTGGCCCCATTAACGTTGGCAACTATCGCTTTGTCTTTGAGGCAGACCCTCCAGATGCATTAAAAATCCGTGAAGA...

Protein

Download Protein FASTA

221 aa · TkA06G086180|TK1151|PROTEIN

MSAVNLTNVSVLNNPSPFLSPFQFEISYECLLPLKDDLEWKLTYVGSAEDETYDQLLESVLVGPINVGNYRFVFEADPPDALKIREEDIIGVTVLLLTCSYLGQEFVRVGYYVNNDYEDEHLKEEPPQKVLIDKVQRNILADKPRVTKFPINFHPENIEQSEQPQDLPEIETEQEEHQQTVASPQRNSEELNPVDCEIKNDVKEETETVLLKDHLPPVVSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G086180`
TK1151 ID	TkA06G086180
OH-1004 ID	LXL04_025032
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G086180

Location Chr06:23061512-23063078 (-)

Description Similar to ASF1A: Probable histone chaperone ASF1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66740`	Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly (By similarity).	No verified direct reference in this release
`At5g38110`	Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006334 nucleosome assembly Biological Process

GO:0006335 DNA replication-dependent chromatin assembly Biological Process

GO:0006337 nucleosome disassembly Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0010091 trichome branching Biological Process

GO:0030466 silent mating-type cassette heterochromatin formation Biological Process

GO:0031509 subtelomeric heterochromatin formation Biological Process

KEGG gene cross-reference

afm:AFUA_3G11030

ani:ANIA_04891

ath:AT1G66740

ath:AT5G38110

dme:Dmel_CG9383

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.614

Rank 1 · TkA06G086180 · TK1151

Nucleus0.361

Rank 2 · TkA06G086180 · TK1151

Cell membrane0.061

Rank 3 · TkA06G086180 · TK1151

Golgi apparatus0.059

Rank 4 · TkA06G086180 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA06G086180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04729ASF1_hist_chap1-154 aa

PF11871DUF339190-180 aa

PF16326ABC_tran_CTD159-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G086180	`PF04729`	ASF1_hist_chap	1	154	2.4e-71	239.3
TkA06G086180	`PF11871`	DUF3391	90	180	0.069	14.4
TkA06G086180	`PF16326`	ABC_tran_CTD	159	198	1.1	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9M6`	Arabidopsis thaliana	sp\|Q9C9M6\|ASF1A_ARATH Probable histone chaperone ASF1A	86.500%	Swiss-Prot	High
`Q9LS09`	Arabidopsis thaliana	sp\|Q9LS09\|ASF1B_ARATH Histone chaperone ASF1B	84.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card