TkA06G085940 | RubberDandelionOmics

Gene overview

TkA06G085940

Reference: TK1151 Chr: Chr06 Coordinates: 23007704-23010493 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1427 bp · TkA06G085940|TK1151|cDNA

ATTTGGTAACCCATTATTTAAGTTACATTTTGTGTTTAAGTTATTGCAATTATGAACCACTTTAACTATTATTATTGCAATTATGAACACCTCAATTTCACTTTTTTCAGACTTATATTAAATATATTTACGTTATGCTCCGTTATCTTTAACATAATGTTAACTTAAGGTTGGGACATTATAAATGGCTTTTGCCCCGGGCATGAAAACCCACTGGACCGTCCCTGAACACAGTTTACTTAAAAGTCTTCAGACATTTC...

CDS

Download CDS FASTA

639 bp · TkA06G085940|TK1151|CDS

ATGTGTTCAGTTTCTAGGCTTTTCACGACGCCCCTGCTTCTCTGTAGCTTCATATCATTATCCCTGTTCTCATCGGCGTCGCTGATTGATTCCGCGGCCGGATCTCGACGGCTCCTGCGTGCAATTACCACCGGTGGTGATCAGCCTGATTTCGCTGTTGATTTGAACGTCACCAACTTCGATGAAGTTCTCAGGGATACCCCCGCGCCTTTCGCGATTGTGGAATTCTTCGCCCACTGGTGCCCTGCCTACAGAAATTA...

Protein

Download Protein FASTA

212 aa · TkA06G085940|TK1151|PROTEIN

MCSVSRLFTTPLLLCSFISLSLFSSASLIDSAAGSRRLLRAITTGGDQPDFAVDLNVTNFDEVLRDTPAPFAIVEFFAHWCPAYRNYKPQYEKVARLFNGANVIHPGIVLMTRVDCGIKVNTNLCDKFSISHYPSLFWGPTSKFVGGSWDGKNEKGEIRYIEDGRTSDRLLKWINTQTESLYNLEDEKYENAELLQSNTSSHGQIPRAISDV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G085940`
TK1151 ID	TkA06G085940
OH-1004 ID	LXL04_025041
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 98.585 / OH-1004 55.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G085940

Location Chr06:23007704-23010493 (-)

Description Similar to QSOX2: Sulfhydryl oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01270`	Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide.	No verified direct reference in this release
`At1g15020`	Sulfhydryl oxidase involved in the regulation of cation homeostasis.	An Arabidopsis quiescin-sulfhydryl oxidase regulates cation homeostasis at the root symplast-xylem interface.2007 · DOI: 10.1038/sj.emboj.7601757

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0552500`	Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0043157 response to cation stress Biological Process

GO:0043268 positive regulation of potassium ion transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G15020

ath:AT2G01270

ddi:DDB_G0276141

dosa:Os05g0156300

dosa:Os05g0552500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.334

Rank 1 · TkA06G085940 · TK1151

Endoplasmic reticulum0.302

Rank 2 · TkA06G085940 · TK1151

Lysosome / Vacuole0.126

Rank 3 · TkA06G085940 · TK1151

Cytoplasm0.095

Rank 4 · TkA06G085940 · TK1151

Cell membrane0.074

Rank 5 · TkA06G085940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085Thioredoxin54-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G085940	`PF00085`	Thioredoxin	54	158	1.3e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU40`	Arabidopsis thaliana	sp\|Q9ZU40\|QSOX2_ARATH Sulfhydryl oxidase 2	64.300%	Swiss-Prot	High
`Q8W4J3`	Arabidopsis thaliana	sp\|Q8W4J3\|QSOX1_ARATH Sulfhydryl oxidase 1	56.900%	Swiss-Prot	High
`Q6AUC6`	Oryza sativa subsp. japonica	sp\|Q6AUC6\|QSOX1_ORYSJ Sulfhydryl oxidase 1	60.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card