TkA06G082150 | RubberDandelionOmics

Gene overview

TkA06G082150

Reference: TK1151 Chr: Chr06 Coordinates: 22046109-22047951 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA06G082150|TK1151|cDNA

ATGGATTTTGCTGGTTTTATACATTCCAACAGCATTCAAGGCTTAAACAATCGATTACAGGAGGTCAAAGTCTGTTTGTTTCTCAGTTCACAGTTCAAATCAGTTCACAGTTCAAACCACCTTGCCTTCTTTGCAGTATATAACGTGGAATCAACAGAAATTATTGCATTTTATCAGATGTCATCCGAAAAGCTGTATATATTATTTGAACAGTTTTGTGATCATTTCCATGTACCATCAAAAAACTCCCCCTACATGAA...

CDS

Download CDS FASTA

591 bp · TkA06G082150|TK1151|CDS

ATGGATTTTGCTGGTTTTATACATTCCAACAGCATTCAAGGCTTAAACAATCGATTACAGGAGGTCAAAGTCTGTTTGTTTCTCAGTTCACAGTTCAAATCAGTTCACAGTTCAAACCACCTTGCCTTCTTTGCAGTATATAACGTGGAATCAACAGAAATTATTGCATTTTATCAGATGTCATCCGAAAAGCTGTATATATTATTTGAACAGTTTTGTGATCATTTCCATGTACCATCAAAAAACTCCCCCTACATGAA...

Protein

Download Protein FASTA

196 aa · TkA06G082150|TK1151|PROTEIN

MDFAGFIHSNSIQGLNNRLQEVKVCLFLSSQFKSVHSSNHLAFFAVYNVESTEIIAFYQMSSEKLYILFEQFCDHFHVPSKNSPYMNFISSHSNNIHALDQLRSSKNKATSFSLGRATPYPYIQNEANELLRIRDYLFKELAQKTGQPVEQVHKDFSRIKRFNAQEALDYGLIDRIVSPPRIKVDAPSKEAGTGLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G082150`
TK1151 ID	TkA06G082150
OH-1004 ID	LXL04_021241
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 47.689 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G082150

Location Chr06:22046109-22047951 (-)

Description Similar to CLPR2: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12410`	Required for chloroplast development and integrity.	Downregulation of ClpR2 leads to reduced accumulation of the ClpPRS protease complex and defects in chloroplast biogenesis in Arabidopsis.2006 · DOI: 10.1105/tpc.106.042861
`At4g10180`	Component of light signal transduction machinery.	Arabidopsis COP10 forms a complex with DDB1 and DET1 in vivo and enhances the activity of ubiquitin conjugating enzymes.2004 · DOI: 10.1101/gad.1229504 DET1-mediated degradation of a SAGA-like deubiquitination module controls H2Bub homeostasis.2018 · DOI: 10.7554/elife.37892 DET1 represses a chloroplast blue light-responsive promoter in a developmental and tissue-specific manner in Arabidopsis thaliana.1998 · DOI: 10.1046/j.1365-313x.1998.00078.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021241 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

KEGG gene cross-reference

ath:AT1G12410

ath:AT4G10180

cyp:PCC8801_0943

pma:Pro_1388

sly:778329

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA06G082150 · TK1151

Nucleus0.396

Rank 2 · TkA06G082150 · TK1151

Mitochondrion0.162

Rank 3 · TkA06G082150 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA06G082150 · TK1151

Cell membrane0.065

Rank 5 · TkA06G082150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00621RhoGEF30-112 aa

PF09737Det133-111 aa

PF22950DUF702667-79 aa

PF00574CLP_protease123-178 aa

PF01343Peptidase_S49128-177 aa

PF29026DUF4350_C134-168 aa

PF22950DUF7026134-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G082150	`PF00621`	RhoGEF	30	112	0.95	10.3
TkA06G082150	`PF09737`	Det1	33	111	3e-18	66.8
TkA06G082150	`PF22950`	DUF7026	67	79	0.16	12.3
TkA06G082150	`PF00574`	CLP_protease	123	178	1.1e-12	48.9
TkA06G082150	`PF01343`	Peptidase_S49	128	177	0.3	11.8
TkA06G082150	`PF29026`	DUF4350_C	134	168	0.049	14.6
TkA06G082150	`PF22950`	DUF7026	134	159	0.16	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XJ36`	Arabidopsis thaliana	sp\|Q9XJ36\|CLPR2_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic	70.300%	Swiss-Prot	Low
`P48732`	Arabidopsis thaliana	sp\|P48732\|DET1_ARATH Light-mediated development protein DET1	62.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card