TkA06G081320 | RubberDandelionOmics

Gene overview

TkA06G081320

Reference: TK1151 Chr: Chr06 Coordinates: 21833412-21835013 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1572 bp · TkA06G081320|TK1151|cDNA

ATGTGGGATGAAACTGAACTACAAGATACCGGCGATGATGAGCTGTTTGCGATGCTCGGGTACAATATTAGGTCGTCTGACATGGCTGAGGTCGCCGATAAAATTCAGCACCTTGAAGAAGCTTTGGTGAATGACGACGAATTATCTCAACTTGCCTCCGATTCCGTTCATTACAATCCTTCCAATTTATCGACGTGGCTTGAGACCATGATGGTGGAGTTGAACCCTACTAGTCAGCAACAGCTTGTGATCGATGACTC...

CDS

Download CDS FASTA

1572 bp · TkA06G081320|TK1151|CDS

ATGTGGGATGAAACTGAACTACAAGATACCGGCGATGATGAGCTGTTTGCGATGCTCGGGTACAATATTAGGTCGTCTGACATGGCTGAGGTCGCCGATAAAATTCAGCACCTTGAAGAAGCTTTGGTGAATGACGACGAATTATCTCAACTTGCCTCCGATTCCGTTCATTACAATCCTTCCAATTTATCGACGTGGCTTGAGACCATGATGGTGGAGTTGAACCCTACTAGTCAGCAACAGCTTGTGATCGATGACTC...

Protein

Download Protein FASTA

523 aa · TkA06G081320|TK1151|PROTEIN

MWDETELQDTGDDELFAMLGYNIRSSDMAEVADKIQHLEEALVNDDELSQLASDSVHYNPSNLSTWLETMMVELNPTSQQQLVIDDSAVTNGTANDDAAVTAPVEATATSVFMDNLVSVPDVAIQPASASASASNNPNAAVVLVDSQNNGIRLVHTLLACARAVHDENFQLAENLVKQAGILAVSQTGPMKKVAGYFSEALARRIYGYRPQSPQDSPAFNDLLQMHFYEACPYMKFAHFTSNQAILEAFAGKKKVHVIDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G081320`
TK1151 ID	TkA06G081320
OH-1004 ID	LXL04_025086
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 99.809 / OH-1004 94.494 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G081320

Location Chr06:21833412-21835013 (+)

Description Similar to GAI1: DELLA protein GAI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14920`	Transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025086 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006808 regulation of nitrogen utilization Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010187 negative regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT1G14920

mtr:25489240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.846

Rank 1 · TkA06G081320 · TK1151

Cytoplasm0.192

Rank 2 · TkA06G081320 · TK1151

Cell membrane0.046

Rank 3 · TkA06G081320 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA06G081320 · TK1151

Plastid0.031

Rank 5 · TkA06G081320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12041DELLA13-78 aa

PF30870At4g37920_C31-79 aa

PF04748Polysacc_deac_269-166 aa

PF03514GRAS153-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G081320	`PF12041`	DELLA	13	78	2.2e-27	95.5
TkA06G081320	`PF30870`	At4g37920_C	31	79	0.076	14.1
TkA06G081320	`PF04748`	Polysacc_deac_2	69	166	0.014	15.2
TkA06G081320	`PF03514`	GRAS	153	521	1.8e-125	419.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQT8`	Arabidopsis thaliana	sp\|Q9LQT8\|GAI_ARATH DELLA protein GAI	57.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card