RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G081150
Reference: TK1151 Chr: Chr06 Coordinates: 21786842-21789209 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1640 bp · TkA06G081150|TK1151|cDNA

AACACAAGTAGACAACACAACACAACATAACACAAAGGTTATTTTTTTATTTGATTATTTGTTCTTTAATGGGGGGATCTTCCACTTACCAAAAAGCATGACCAAATCCAAGAACTTCTTTCACAACATCATCAAAACCTTCAATTCCAGCTCAAATAAAGGTAAAGATAACCAAGAAGAAGATTTGGGAAAGCTCGCTGCTCAAGATCAAAAAGTTTTCACTTTTCAAACCCTAGTTTCCGCAACAAAGAATTTCGATC...

CDS

Download CDS FASTA

1227 bp · TkA06G081150|TK1151|CDS

ATGACCAAATCCAAGAACTTCTTTCACAACATCATCAAAACCTTCAATTCCAGCTCAAATAAAGATAACCAAGAAGAAGATTTGGGAAAGCTCGCTGCTCAAGATCAAAAAGTTTTCACTTTTCAAACCCTAGTTTCCGCAACAAAGAATTTCGATCCTGATAACAAGCTTGGTCAAGGGGGTTTTGGCCCTGTTTTCAAGGGTAAATTGGATAATGGAGTGGAGATTGCGGTGAAGAAATTATCCCAAACCTCAAATCA...

Protein

Download Protein FASTA

408 aa · TkA06G081150|TK1151|PROTEIN

MTKSKNFFHNIIKTFNSSSNKDNQEEDLGKLAAQDQKVFTFQTLVSATKNFDPDNKLGQGGFGPVFKGKLDNGVEIAVKKLSQTSNQGKKEFVNEAKLLARVQHRNVVDLLGYCVSPEKLLVYEYVPNESLDKLLFKSSTRDELDWKRRYDIICGVARGLLYLHEDAHDCIIHRDIKASNILLDEKWVPKIADFGMAKLYPEDQTHVHTRVAGTNGYMAPEYVMRGNLSVKADVYSFGVVVLELISGQKNFTFNLDPECI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G081150
TK1151 IDTkA06G081150
OH-1004 IDLXL04_025089
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.600
Protein coverage (%)TK1151 100.000 / OH-1004 99.516
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G081150
LocationChr06:21786842-21789209 (-)
DescriptionSimilar to CRK19: Cysteine-rich receptor-like protein kinase 19
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g70740 Cysteine-rich receptor-like protein kinase 43. No verified direct reference in this release
At4g11530 Cysteine-rich receptor-like protein kinase 34. No verified direct reference in this release
At4g23270 Cysteine-rich receptor-like protein kinase 19. No verified direct reference in this release
At4g23180 Cysteine-rich receptor-like protein kinase 10. No verified direct reference in this release
At4g00960 Cysteine-rich receptor-like protein kinase 44. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025089 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0012501 programmed cell death Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G70740
ath:AT4G23180
ath:AT4G23270
ath:AT4G23280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.714
Rank 1 · TkA06G081150 · TK1151
Cytoplasm0.238
Rank 2 · TkA06G081150 · TK1151
Nucleus0.189
Rank 3 · TkA06G081150 · TK1151
Endoplasmic reticulum0.038
Rank 4 · TkA06G081150 · TK1151
Golgi apparatus0.027
Rank 5 · TkA06G081150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17667Pkinase_fungal12-42 aa
PF07714PK_Tyr_Ser-Thr54-318 aa
PF00069Pkinase54-317 aa
PF03109ABC158-81 aa
PF17667Pkinase_fungal91-110 aa
PF01636APH95-142 aa
PF03109ABC1116-204 aa
PF14531Kinase-like133-246 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G081150PF17667Pkinase_fungal12420.0001921.0
TkA06G081150PF07714PK_Tyr_Ser-Thr543183.5e-49168.1
TkA06G081150PF00069Pkinase543176.3e-48164.2
TkA06G081150PF03109ABC158810.0007419.5
TkA06G081150PF17667Pkinase_fungal911100.0001921.0
TkA06G081150PF01636APH951420.02215.2
TkA06G081150PF03109ABC11162040.0007419.5
TkA06G081150PF14531Kinase-like1332460.2911.1
TkA06G081150PF17667Pkinase_fungal1632370.0001921.0
TkA06G081150PF01636APH1662000.02215.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9CAC3Arabidopsis thalianasp|Q9CAC3|CRK43_ARATH Cysteine-rich receptor-like protein kinase 4363.000%Swiss-ProtHigh
Q9LDQ3Arabidopsis thalianasp|Q9LDQ3|CRK34_ARATH Cysteine-rich receptor-like protein kinase 3451.700%Swiss-ProtHigh
Q8GWJ7Arabidopsis thalianasp|Q8GWJ7|CRK19_ARATH Cysteine-rich receptor-like protein kinase 1952.200%Swiss-ProtHigh
Q8GYA4Arabidopsis thalianasp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 1052.000%Swiss-ProtHigh
O23082Arabidopsis thalianasp|O23082|CRK44_ARATH Cysteine-rich receptor-like protein kinase 4453.000%Swiss-ProtHigh

JBrowse

View in Genome Browser