TkA06G078480 | RubberDandelionOmics

Gene overview

TkA06G078480

Reference: TK1151 Chr: Chr06 Coordinates: 21059984-21063228 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2852 bp · TkA06G078480|TK1151|cDNA

ATTAATAGTTTAGTGGTTAAGACTTTCTTTCAATTCAACAAAGAAGTTCTTAATTAAGAAATAAAAACTATACAACCAAAACCTTCATAAATACTAACTCAACTATGTTGATTTGTATAAAATCCCCTAACTTCTTGAACAACTTCAGAAACAATCCCAAGAATCCTTTAAGCTTCTAATTGAAATATCCTACTAGAAGATGATGAAAGCCGAGCAACTCGAAGTAGGAGGTGCTACATCTAAGGTCCCGACCCGAGTTG...

CDS

Download CDS FASTA

588 bp · TkA06G078480|TK1151|CDS

ATGATGAAAGCCGAGCAACTCGAAGTAGGAGGTGCTACATCTAAGGTCCCGACCCGAGTTGGGTCAAACAAAGGGGTTTCCCTAATGGACCTCATTCTACGCATTGTTGGAGTCGTGGGTACTTTAGGTAGCTCCATAGCCATGGGAACAACGGAACAAACCTTATCTTTTTTCACACGTTTTGTTCGTTTCAGTGCCCAATATGATGATTTTCCATCTTTCAGATTGTTTGTGATTGTGAATGCAATAGTATGCGCCTA...

Protein

Download Protein FASTA

195 aa · TkA06G078480|TK1151|PROTEIN

MMKAEQLEVGGATSKVPTRVGSNKGVSLMDLILRIVGVVGTLGSSIAMGTTEQTLSFFTRFVRFSAQYDDFPSFRLFVIVNAIVCAYLVLTIPLSIVHIMRSAARGSRILLVILDTVMLGLLTAGASTATSIVYLAHNGNSSANWLPVCQQFNDFCQRASGSLIGSYGAIVMFILLILLAAIALSRQKKTHFERL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G078480`
TK1151 ID	TkA06G078480
OH-1004 ID	LXL04_025148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G078480

Location Chr06:21059984-21063228 (+)

Description Similar to Casparian strip membrane protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YAZ1`	Regulates membrane-cell wall junctions and localized cell wall deposition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007043 cell-cell junction assembly Biological Process

GO:0042545 cell wall modification Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

gmx:100500346

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.868

Rank 1 · TkA06G078480 · TK1151

Endoplasmic reticulum0.076

Rank 2 · TkA06G078480 · TK1151

Cytoplasm0.059

Rank 3 · TkA06G078480 · TK1151

Lysosome / Vacuole0.036

Rank 4 · TkA06G078480 · TK1151

Nucleus0.028

Rank 5 · TkA06G078480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30735DUF871423-180 aa

PF04535CASP_dom24-171 aa

PF19779DUF626432-101 aa

PF19779DUF6264120-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G078480	`PF30735`	DUF8714	23	180	0.0085	15.7
TkA06G078480	`PF04535`	CASP_dom	24	171	2e-46	158.2
TkA06G078480	`PF19779`	DUF6264	32	101	0.0021	19.0
TkA06G078480	`PF19779`	DUF6264	120	188	0.0021	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2YAZ1`	Oryza sativa subsp. indica	sp\|A2YAZ1\|CASP3_ORYSI Casparian strip membrane protein 3	59.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card