TkA06G077260 | RubberDandelionOmics

Gene overview

TkA06G077260

Reference: TK1151 Chr: Chr06 Coordinates: 20719153-20720562 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · TkA06G077260|TK1151|cDNA

AACTTTAGAATCAGCGCAGAGGTGTAGGCCGCCGGAAGTGAGAGGGAGATATCACTCAATTAACCGCCGGGTTGACGTCGGACAAACATGGTTCACGTCTCTTTCTACCGCAACTATGGAAAAACCTTCAAGAAGCCCCGTCGTCCATATGAGAAGGAGCGATTAGATGCTGAGTTGAAACTCGTTGGAGAGTACGGCCTTCGCTGCAAAAGGGAGCTATGGAGGGTGCAATACGCTCTGAGCCGAATCCGTAATGCAGC...

CDS

Download CDS FASTA

594 bp · TkA06G077260|TK1151|CDS

ATGGTTCACGTCTCTTTCTACCGCAACTATGGAAAAACCTTCAAGAAGCCCCGTCGTCCATATGAGAAGGAGCGATTAGATGCTGAGTTGAAACTCGTTGGAGAGTACGGCCTTCGCTGCAAAAGGGAGCTATGGAGGGTGCAATACGCTCTGAGCCGAATCCGTAATGCAGCAAGAATGCTCTTAACCCTGGAAGAAAAAGATCCACGCAGGATCTTCGAGGGAGAAGCCCTAATGAGGAGAATGAACAGATACGGTCT...

Protein

Download Protein FASTA

197 aa · TkA06G077260|TK1151|PROTEIN

MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLLTLEEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQKAAAKKASGGDADEDDEE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G077260`
TK1151 ID	TkA06G077260
OH-1004 ID	LXL04_011478
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G077260

Location Chr06:20719153-20720562 (-)

Description Similar to RPS9C: 40S ribosomal protein S9-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39850`	Small ribosomal subunit protein uS4y.	No verified direct reference in this release
`At5g15200`	Small ribosomal subunit protein uS4z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011478 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0000228 nuclear chromosome Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G15200

ath:AT5G39850

dme:Dmel_CG3395

dya:Dyak_GE21228

rno:103689992

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.783

Rank 1 · TkA06G077260 · TK1151

Nucleus0.406

Rank 2 · TkA06G077260 · TK1151

Endoplasmic reticulum0.071

Rank 3 · TkA06G077260 · TK1151

Mitochondrion0.016

Rank 4 · TkA06G077260 · TK1151

Cell membrane0.013

Rank 5 · TkA06G077260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00163Ribosomal_S48-108 aa

PF07528DZF_N29-69 aa

PF07528DZF_N99-161 aa

PF01479S4109-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G077260	`PF00163`	Ribosomal_S4	8	108	1.7e-14	55.0
TkA06G077260	`PF07528`	DZF_N	29	69	0.18	12.5
TkA06G077260	`PF07528`	DZF_N	99	161	0.18	12.5
TkA06G077260	`PF01479`	S4	109	153	4e-12	46.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLF0`	Arabidopsis thaliana	sp\|Q9FLF0\|RS92_ARATH Small ribosomal subunit protein uS4y	89.800%	Swiss-Prot	High
`Q9LXG1`	Arabidopsis thaliana	sp\|Q9LXG1\|RS91_ARATH Small ribosomal subunit protein uS4z	87.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card