TkA06G076340 | RubberDandelionOmics

Gene overview

TkA06G076340

Reference: TK1151 Chr: Chr06 Coordinates: 20489041-20492885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkA06G076340|TK1151|cDNA

CGAACATGATCGAGAGACCATGTAGCACACACAGTAGCGATTAGTGGAGTTGACTAAACGTCTTTCTGCATTTCAGTACTTGTTTCCAAGCAATCGTTAAATCGGGTGCCAACATCCACAAGTCAAAAGATGAAGAAATTCTTCTTCAATCGGATATTGTTTTGTTTTACCCTCTCCAATTTCTGTTTGTTCTCCATCATGTTCGCCGATTCCGGTCAAGACTCGCTACTCGGATCAGCTCGCGTTGTTTTTCAGACAAA...

CDS

Download CDS FASTA

696 bp · TkA06G076340|TK1151|CDS

ATGAAGAAATTCTTCTTCAATCGGATATTGTTTTGTTTTACCCTCTCCAATTTCTGTTTGTTCTCCATCATGTTCGCCGATTCCGGTCAAGACTCGCTACTCGGATCAGCTCGCGTTGTTTTTCAGACAAATTATGGGGACATTGAATTTGGTTTCTACCCTACTGTGGCTCCTCAAACAGTCGAACACATTTACAAACTTGTTCGTTTGGGATGCTATAATACAAACCACTTCTTTCGGGTAGATAAGGGGTTTGTTGC...

Protein

Download Protein FASTA

231 aa · TkA06G076340|TK1151|PROTEIN

MKKFFFNRILFCFTLSNFCLFSIMFADSGQDSLLGSARVVFQTNYGDIEFGFYPTVAPQTVEHIYKLVRLGCYNTNHFFRVDKGFVAQVADVSNGRTAPMNEEQRTEADKTIKGEFSDVKHVRGILSMGRYSDPNSAQSSFSMLLGDAPHLDHEYAIFGKVTKGDETLKKLEELPTRREGIFVMPLERITILSTYYYDTEMETCQQDKSVLKRRLAASAVEIERQRMKCFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G076340`
TK1151 ID	TkA06G076340
OH-1004 ID	LXL04_025187
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G076340

Location Chr06:20489041-20492885 (-)

Description Similar to CYP23: Peptidyl-prolyl cis-trans isomerase CYP23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26940`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025187 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0003755 peptidyl-prolyl cis-trans isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26940

bmb:BruAb1_1100

bme:BMEI0887

bmel:DK63_534

bmf:BAB1_1118

bms:BR1094

bsi:BS1330_I1090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.311

Rank 1 · TkA06G076340 · TK1151

Mitochondrion0.187

Rank 2 · TkA06G076340 · TK1151

Endoplasmic reticulum0.143

Rank 3 · TkA06G076340 · TK1151

Nucleus0.133

Rank 4 · TkA06G076340 · TK1151

Extracellular0.113

Rank 5 · TkA06G076340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160Pro_isomerase39-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G076340	`PF00160`	Pro_isomerase	39	193	9.4e-34	117.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDR3`	Arabidopsis thaliana	sp\|Q8LDR3\|CYP23_ARATH Peptidyl-prolyl cis-trans isomerase CYP23	84.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card