TkA06G075380 | RubberDandelionOmics

Gene overview

TkA06G075380

Reference: TK1151 Chr: Chr06 Coordinates: 20210891-20213111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · TkA06G075380|TK1151|cDNA

ATGGAGAATGTTTGCCCCTCCCTCCCGATGTACCCACAGACCCGTGTTCGATTCCATGGACAAAGCTCAAATATTTTTAGATCTAGCCTTTCAACACTTAGAGGAAAAAATCAGATCTACACTTCTACTGCCCACTGCTCTGTACCCCGTCTCTCCCATTCACGCGATCTACCCCATCTTGAACGCCGGATTCACGCCGCGATCTGCCCCATCTTTGAACGCCGCTGTCTGATTTTGAACGCCGGAGCTGTATCATTCTT...

CDS

Download CDS FASTA

1425 bp · TkA06G075380|TK1151|CDS

ATGGAGAATGTTTGCCCCTCCCTCCCGATGTACCCACAGACCCGTGTTCGATTCCATGGACAAAGCTCAAATATTTTTAGATCTAGCCTTTCAACACTTAGAGGAAAAAATCAGATCTACACTTCTACTGCCCACTGCTCTGTACCCCGTCTCTCCCATTCACGCGATCTACCCCATCTTGAACGCCGGATTCACGCCGCGATCTGCCCCATCTTTGAACGCCGCTGTCTGATTTTGAACGCCGGAGCTGTATCATTCTT...

Protein

Download Protein FASTA

474 aa · TkA06G075380|TK1151|PROTEIN

MENVCPSLPMYPQTRVRFHGQSSNIFRSSLSTLRGKNQIYTSTAHCSVPRLSHSRDLPHLERRIHAAICPIFERRCLILNAGAVSFFPALSRLVKPLSNSSWRCLDRSQLVTQLSHFERRWSRRIASEWWSPVFSHSRRCLHCSSPTDVLFKFHIEPLWVRFKTLYVWDSTQEQRMNTNFQNVVACRYRDAMRMFRIKSALKAIKDGHPISAKGRNFDIMVNYVPRGMQSERWVELCKEWNTVKWLKRSESGANNRNTID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G075380`
TK1151 ID	TkA06G075380
OH-1004 ID	LXL04_035122
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.000
Protein coverage (%)	TK1151 26.371 / OH-1004 19.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G075380`
Location	Chr06:20210891-20213111 (+)
Description	Similar to CIPK2: CBL-interacting protein kinase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035122` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007165 signal transduction Biological Process GO:0009737 response to abscisic acid Biological Process GO:0005634 nucleus Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT5G45820 dosa:Os01g0206700 dosa:Os03g0339900 dosa:Os05g0332300 dosa:Os07g0678600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.857

Rank 1 · TkA06G075380 · TK1151

Cytoplasm0.235

Rank 2 · TkA06G075380 · TK1151

Mitochondrion0.025

Rank 3 · TkA06G075380 · TK1151

Cell membrane0.023

Rank 4 · TkA06G075380 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA06G075380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03004Transposase_24230-376 aa

PF25762HAUS1391-465 aa

PF09893DUF2120395-456 aa

PF03004Transposase_24421-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G075380	`PF03004`	Transposase_24	230	376	3.7e-14	53.8
TkA06G075380	`PF25762`	HAUS1	391	465	0.067	13.7
TkA06G075380	`PF09893`	DUF2120	395	456	0.77	10.5
TkA06G075380	`PF03004`	Transposase_24	421	444	3.7e-14	53.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card